Details for Capsella Locus Carubv10016169m

Position : scaf_3 ( 5`- 3615217 .. 3615900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016169m

Protein [Map View]
MSYSVKGRTLRGNNNNGGGGGGTGTKCGRWNPTVEQLKILTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQN
HKARERQKRRKISIDFDHHHHHHHHQQLSTRDVFEINEEECQEEEKVIETLQLFPVNPFEDSNSKVEKMRARGNNNNNQY
REYIRETSTTSFSPYYSSCGAEMEHPPPLDLRLSFL*

DNA
ATGTCTTACTCTGTGAAAGGTCGAACCTTACGGGGCAACAACAACAACGGAGGAGGAGGAGGAGGGACGGGAACGAAGTG
CGGGAGGTGGAATCCGACCGTGGAGCAGTTGAAGATTCTGACGGATCTGTTCCGAGCCGGTCTTAGAACCCCGACCACTG
ATCAGATTCAGAAGATCTCTACGGAGCTCAGTTTCTACGGCAAGATCGAGAGCAAGAACGTTTTCTATTGGTTCCAGAAC
CATAAGGCTAGGGAGAGGCAGAAACGTCGTAAAATCTCCATTGACTTTGATCATCACCACCATCATCATCATCACCAACA
ATTATCAACTAGAGATGTTTTTGAGATAAACGAAGAAGAGTGTCAAGAGGAAGAGAAGGTGATAGAGACATTACAACTCT
TTCCAGTGAATCCATTTGAAGACTCCAACTCCAAAGTCGAGAAAATGAGAGCTAGAGGCAATAATAACAACAACCAGTAC
CGTGAATACATTCGAGAGACGAGCACGACGTCGTTCTCTCCATATTATTCATCATGTGGAGCTGAGATGGAACACCCTCC
GCCGTTAGATCTTCGATTAAGCTTTCTTTAA