Details for Capsella Locus Carubv10016168m

Position : scaf_3 ( 5`- 8516680 .. 8518832 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016168m

Protein [Map View]
MKMEMSNVKSMCTVLTRSMPAIAFFGRMAFAFVFLISAIQEYADHFGDGGPLEKTVGPAVNAMTKYGSKVLTFYSGMQVV
VFDVRLLEFSLISAKATAALWFIFGQSIPAYFLLVTQMLSTVVPFPTNLNDFTQNLTLIGALLYYIGLKHSIDNLDKSEK
NKDKETEEDDEASTSKAKVN*

DNA
ATGAAGATGGAAATGTCAAATGTCAAGAGCATGTGCACGGTATTAACAAGGTCGATGCCAGCCATTGCCTTCTTTGGGAG
AATGGCATTTGCTTTTGTCTTTCTCATTTCTGCTATCCAAGAGTATGCTGATCATTTTGGCGATGGCGGGCCACTCGAGA
AGACGGTAGGACCAGCCGTGAATGCGATGACCAAATACGGTTCTAAGGTTCTCACATTTTACTCTGGAATGCAAGTGGTT
GTGTTCGATGTTCGACTTCTTGAATTCTCACTCATAAGTGCAAAAGCAACTGCAGCTTTGTGGTTCATCTTTGGACAATC
CATCCCAGCATACTTCTTGCTCGTAACACAAATGCTCTCAACTGTTGTTCCTTTCCCTACCAACTTGAATGACTTCACTC
AGAACTTGACATTAATCGGGGCGTTGCTCTATTACATTGGATTGAAGCATAGTATCGACAACCTTGACAAGTCAGAGAAG
AACAAGGATAAAGAGACAGAGGAAGATGACGAGGCCTCAACTTCCAAAGCAAAAGTAAACTGA