Details for Capsella Locus Carubv10016161m

Position : scaf_3 ( 5`- 7774404 .. 7777263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016161m

Protein [Map View]
MQYLSQSRRIARVLKPLAFVEADARFVSTASHAVQWPSHRSLSYSAFPGMDNCNQLYAQSRLMTASMISRANFSSEAKRV
ENPTESVKELHAKIFDSVNVKRSMPPNAWLWSLIDKCRKEDDISFLFDVLQNLRRFRLSNLRIHDNFNCNLCRQVAKTCV
SVGAINHGKRALWKHNVHGLTPSVASAHHLLSYALEHKDVKLMDEVMKLLKMNNLPLQPGTADLVFRGLKYSCFRICHDT
DNWDLLAKYSKKFCKAGVKLRKTTFDVWMEFAAKRGDSKSLWNVDKLRSETYTQHTLSGAFSCAKGFLLEHKPEEAAAVI
QILCQAYPDEKKLVLEAEFKKLVNEWPVDIMKHQNEEDKKAVVASLRSNIPAMVNALVNSGLRVNVDMDDWNKNEALLS*

DNA
ATGCAGTATCTATCGCAGTCTCGTAGAATCGCTAGGGTTTTGAAACCTCTGGCTTTTGTCGAGGCTGATGCGAGATTTGT
ATCCACTGCTTCTCACGCTGTTCAATGGCCGAGCCATCGATCTCTTTCCTACTCTGCATTTCCAGGGATGGATAATTGCA
ATCAGTTGTACGCTCAATCACGACTTATGACGGCGTCGATGATTTCGAGAGCAAACTTTTCCTCTGAAGCAAAACGTGTA
GAAAATCCTACAGAGTCTGTCAAGGAATTACATGCTAAAATATTTGATTCTGTTAATGTCAAGAGATCGATGCCTCCAAA
TGCCTGGTTGTGGTCATTAATTGACAAGTGTCGTAAGGAGGATGACATTAGTTTTCTTTTTGACGTTCTGCAGAATCTAC
GGAGATTTAGATTGTCCAACCTTCGTATCCATGACAACTTTAACTGCAATCTATGCCGGCAAGTTGCTAAGACTTGTGTA
AGTGTGGGGGCAATTAACCATGGTAAAAGAGCACTTTGGAAACATAACGTTCATGGTTTGACTCCTAGTGTTGCATCTGC
ACACCATTTACTGTCATACGCATTAGAGCACAAGGACGTGAAACTCATGGACGAAGTAATGAAACTCCTGAAAATGAATA
ACCTGCCTTTACAACCTGGGACAGCGGATTTGGTTTTCAGGGGTTTGAAATACTCGTGCTTTCGGATCTGTCATGATACA
GATAACTGGGATCTATTAGCTAAGTACTCAAAGAAGTTCTGCAAAGCTGGAGTCAAGCTCAGGAAGACCACATTTGATGT
ATGGATGGAATTTGCTGCCAAAAGAGGAGACTCAAAGTCGTTATGGAATGTTGATAAACTGAGATCTGAGACTTACACTC
AACACACCCTTTCCGGGGCTTTTTCATGTGCCAAGGGTTTTCTGCTAGAACATAAACCAGAAGAAGCTGCTGCTGTCATC
CAAATTCTATGTCAGGCATATCCTGATGAGAAGAAGTTGGTACTTGAGGCTGAATTCAAGAAGCTGGTAAATGAGTGGCC
GGTGGACATTATGAAGCACCAAAATGAAGAAGATAAGAAGGCTGTAGTTGCTTCTCTGAGATCCAACATCCCTGCAATGG
TCAACGCTTTAGTAAACTCAGGTTTGAGAGTGAACGTGGATATGGATGACTGGAACAAAAATGAAGCTCTTCTCAGCTGA