Details for Capsella Locus Carubv10016154m

Position : scaf_3 ( 5`- 3867256 .. 3870751 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016154m

Protein [Map View]
MELGKILSGKIKFCRESRRKSERVRNGKGSNNISWDNVFVSPYSNSNSNGSNHDHPATLIRKSPGETQIPMKEISIHDDD
GPHHLKILTPHPLLPKLEPPRGRLVSLEELLPPPVKFTADLMRFVRQSGDAISKRLSVCDDAVARSDVTEFNISGVKVVV
KLKSEEEIRGRVTFFSRSNCRDSTAVRLFFRERGFDYSEINIDVYTEREKELIERTGNSQVPQIFFNEKHLGGFVALNSL
RNSGEFDQRIKEFLTEKCPADAPLPVMYGFDEESNKDVVGDEMMCFVRVLRQKLPIKDRLMKMKIVKNCFSGGEMIEILI
HHLACPRIKAIEIGKRLAKKHFIHHVFGENEFEDGNHYYRFLEHEPFISKCYNFRGSTNDMEPQSAAVVGQRLFKIMIAI
LESYSSNDHTSVDYMRISQSEEFRRYLNMAQDLHRLNLVELSKEEKLAFFLNLYNAMVIHALIRIGLPEGMIARRSFFTD
FQYVVGGYSYSLSSIRNDILRGGHRLSNPFISMINGNTHHELGLQKLNPLVHFGLCDGTKSSPVVRFFTPQGVEAELKRA
AREFFQNGGIEIALDKRTIHLSRIMKWYKEDFTEDKKMFKWIMSYIDANKAGLLTHLLGDGGGSVNIVYQDYDWSINN*

DNA
ATGGAGCTAGGAAAAATTCTCAGTGGAAAAATTAAATTTTGTCGTGAAAGTCGGAGAAAATCTGAGAGAGTTAGAAACGG
TAAAGGAAGCAACAATATCTCTTGGGATAATGTTTTTGTTTCTCCATATTCAAATTCAAACTCTAACGGTAGCAATCACG
ATCATCCCGCCACACTCATTCGTAAGTCCCCGGGAGAAACTCAAATCCCGATGAAGGAAATCTCGATCCACGACGACGAC
GGTCCACATCACCTGAAGATTCTCACACCACATCCTCTGCTCCCGAAACTCGAACCGCCACGTGGCCGTCTTGTCTCCTT
AGAAGAGCTGTTGCCTCCCCCGGTGAAATTCACCGCCGATTTGATGAGATTCGTACGACAAAGCGGAGACGCGATTTCGA
AACGCCTCTCGGTTTGTGACGACGCCGTTGCCAGATCCGACGTGACCGAGTTCAATATCTCCGGAGTCAAAGTCGTGGTG
AAGCTGAAAAGCGAAGAAGAGATCAGAGGTCGTGTAACATTCTTCTCGAGATCTAACTGCCGAGACTCCACCGCCGTCCG
GTTGTTTTTCCGGGAACGAGGCTTCGATTACTCGGAGATCAACATCGACGTTTATACAGAGAGAGAGAAAGAGCTGATCG
AGAGAACAGGGAACTCTCAAGTTCCTCAGATCTTCTTCAACGAGAAACACTTGGGAGGATTCGTTGCGTTGAATTCACTG
AGAAACAGTGGGGAGTTCGATCAGAGGATCAAGGAGTTTTTGACTGAGAAATGTCCCGCCGATGCGCCGTTGCCGGTCAT
GTACGGGTTCGACGAAGAGAGTAATAAGGACGTTGTTGGTGATGAGATGATGTGTTTCGTCAGGGTTTTGAGACAGAAGC
TACCGATTAAAGACCGTTTGATGAAGATGAAGATCGTTAAGAACTGTTTCTCCGGCGGTGAGATGATCGAGATACTCATT
CATCACTTGGCTTGTCCGAGGATCAAGGCCATCGAGATTGGCAAGAGGCTAGCCAAGAAACACTTTATCCACCATGTCTT
TGGAGAAAACGAGTTTGAAGATGGCAATCATTACTATCGTTTCCTTGAGCACGAGCCATTTATTTCAAAATGCTACAATT
TTAGAGGTTCCACCAACGACATGGAGCCCCAAAGTGCAGCCGTGGTTGGGCAGAGGCTTTTCAAAATCATGATTGCTATT
CTTGAGTCTTATTCTTCCAATGACCATACTAGTGTTGACTACATGAGAATTAGCCAGAGCGAAGAATTCAGAAGGTACTT
AAATATGGCTCAAGACCTTCACCGTTTGAATCTTGTGGAACTCTCAAAGGAAGAGAAGTTAGCATTTTTCTTGAACTTGT
ACAACGCAATGGTGATCCATGCCTTGATTAGAATCGGACTTCCCGAGGGAATGATCGCAAGAAGGTCATTCTTTACAGAT
TTTCAGTACGTTGTAGGAGGCTACTCTTATTCCCTTAGCTCCATCCGGAATGACATCCTTCGAGGCGGTCACAGACTTTC
TAATCCATTTATATCCATGATAAACGGCAATACACACCATGAGCTTGGTCTTCAAAAACTGAATCCATTAGTACATTTTG
GGCTCTGCGATGGGACCAAATCAAGTCCAGTGGTGAGGTTTTTCACACCGCAAGGAGTTGAAGCTGAGCTCAAACGAGCA
GCTAGAGAGTTTTTTCAAAATGGTGGAATTGAGATTGCCTTGGACAAGAGGACCATACATCTATCAAGAATCATGAAGTG
GTACAAAGAGGATTTTACTGAAGATAAGAAAATGTTCAAGTGGATAATGAGTTATATAGATGCAAACAAAGCAGGTCTTT
TAACCCATCTTCTTGGTGATGGAGGAGGTTCTGTTAACATTGTTTACCAAGACTATGACTGGTCTATTAACAATTGA