Details for Capsella Locus Carubv10016153m

Position : scaf_3 ( 5`- 1436249 .. 1443250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016153m

Protein [Map View]
MDDISSTASNVARAILAVLDYSSTSDTRKSAVEFLESIKSGDVRVLANISFHFVKKEWSPEIRLHAFKMLQHLVRLRWDE
LSPPECTDLVNVSVELMSEVANACENWPLKSQSAALVAEIVRRQAPDLWQEIFTLLTSLSAQGPLQAELVLMTLRWLPED
ITIHNDDLEGDRRRLLLRGLTQSLPEILPLLYNLLERHFGAAICEARRKHVDLAKQHADVVIACLNAIMAYADWAPVPDL
ARYGILSGCNFLLSSPDFRLHACEVFKLVCSRKRPSDASTAEFDSAISNLFQILTNVSREFLCRSSSSSSVIDENDYVFA
ECICESMASLGSTNLQCISSDGGVMAVYLQQMLGFFQHFKLGLHFEALLFWLSLMRDSLPKPMAAAYLSGEGSSTGGMIS
SSQVDGEKKKTLSLINDDISSALLDVSFQRMLKKEKLPPGITLSLGPLELWSDEFEGKGEFGAYRSKLLDLIKLTAFHKP
LIASTKISERVITLIKHLLASPAPLQDVAVMESQQLALYCIVSTIFDGSNEFAGGCSEVHHALRGVYEGLLQQLLSLKRN
EPELMKVHVHYLDAMGPFLKYFPDAVGSVINKLFELLTSLPHIVKDPATSTSRAARLQICTSFIRIAKAAEKSVLPHMKG
IADTMGYLAKEGTLLRGEHNILGEAFLIMASSAGVSQQQEVLAWLLEPLSQQWIQPEWQNNYLSDPMGLVRLCSNTSLMW
SIFHTVTFFEKALKRSGYRKSNLNKTSVTTPASHPMAHHLSWMLPPLLKLLRVLHSLWSPSVIQILPPELKAAMTMTDAE
RCSLLGEANSKLSKGESVYADGSFDGTKEGKAEASESDIRNWLKGIRESGYNVLGLSTTIGETFFKCLDANYVAMALMEN
LQSMEFRHIRLFIHTYISYIVKSCPADMWDSWLRVLLHPLFIHCQQALSSSWLGLLHEGRAKVPDLFDIQSGSDMKLEVM
EEKLLRDLTREIATLFSTMASRGLNTGVPVLENSGHIGRVDMSTLTDFQAFKSNSMVGFLLNHKSLALPALQICLEAFTW
TDGEATTKVCCFCGVVVLLAILTTNVELREFVSKDLFTAVIRGLGMESNAIISPDLVNICREIFIYLSDRDPAPRQVLLS
LPCLSPNELHTFEEAAAKTSSLKEQKQLMRSLLLLGTGNNLKALAAQKNLISTNVTARSRLPASAPETVGASFL*

DNA
ATGGACGATATCAGCTCAACGGCGAGTAATGTCGCCCGAGCGATTCTCGCCGTCCTCGATTATAGCTCCACGTCCGACAC
TCGCAAATCGGCCGTCGAATTCCTGGAATCTATAAAATCTGGAGATGTCAGGGTTTTGGCAAATATTTCGTTTCATTTTG
TGAAAAAGGAGTGGTCTCCAGAGATTCGTCTGCATGCTTTTAAGATGCTACAGCATCTGGTCAGACTACGATGGGACGAG
TTAAGTCCTCCGGAGTGCACAGATCTTGTTAATGTTTCTGTTGAACTTATGTCAGAGGTTGCAAATGCATGCGAGAATTG
GCCTCTTAAGAGTCAGTCAGCTGCTCTTGTAGCGGAGATTGTTAGAAGACAAGCACCTGATCTTTGGCAAGAAATATTTA
CTTTATTGACTTCCTTGTCTGCTCAGGGCCCCTTACAAGCTGAATTGGTCTTGATGACGCTGAGATGGCTTCCTGAAGAT
ATTACAATTCACAATGACGACTTGGAAGGTGACAGACGTAGGCTATTGTTGCGGGGACTTACTCAATCTTTGCCTGAGAT
TTTGCCTTTATTGTATAATCTTCTTGAGAGACACTTTGGAGCTGCGATATGTGAAGCTCGTAGGAAACACGTTGACCTGG
CAAAACAGCATGCGGATGTGGTTATAGCTTGCTTGAATGCCATCATGGCATATGCTGATTGGGCTCCAGTTCCAGATCTC
GCCAGATATGGAATTCTTAGTGGGTGCAACTTCTTACTTTCTTCCCCTGACTTCCGTCTTCACGCTTGTGAGGTTTTCAA
ACTCGTCTGCTCTAGAAAAAGACCCAGTGATGCTTCTACAGCAGAGTTTGATTCTGCAATTAGCAATTTGTTTCAGATCC
TGACGAACGTCTCCAGAGAATTCTTATGTAGATCCTCCTCAAGTTCAAGCGTTATAGATGAAAATGATTATGTTTTTGCA
GAATGCATATGTGAGAGTATGGCCTCTTTAGGCTCAACTAACTTGCAATGCATCTCCTCTGATGGTGGTGTTATGGCTGT
TTATCTTCAGCAGATGCTTGGATTTTTCCAACACTTCAAGTTGGGCCTTCACTTTGAGGCACTTCTCTTTTGGCTGTCAT
TGATGCGGGATTCACTTCCAAAACCCATGGCTGCAGCTTATCTAAGTGGTGAGGGATCATCAACTGGCGGTATGATTAGT
TCAAGCCAGGTTGATGGTGAAAAGAAAAAGACTTTAAGTCTTATTAATGATGATATCTCTAGCGCTCTACTGGATGTATC
TTTCCAGCGGATGCTCAAGAAAGAAAAACTTCCTCCTGGAATTACTCTTTCGCTTGGGCCCCTTGAACTCTGGAGTGATG
AATTTGAAGGGAAGGGAGAATTTGGCGCGTACCGATCAAAGCTTCTAGACTTGATCAAGCTTACTGCTTTTCACAAGCCT
CTCATTGCTAGTACCAAAATATCTGAAAGAGTGATTACACTCATTAAGCACCTACTGGCTTCTCCAGCACCTCTTCAGGA
TGTAGCTGTGATGGAAAGCCAGCAATTGGCACTTTATTGTATTGTGTCAACGATTTTTGATGGATCAAATGAGTTTGCGG
GGGGATGTTCTGAAGTTCATCATGCATTGCGTGGAGTATATGAGGGATTGCTTCAGCAGCTTCTCTCCTTAAAAAGGAAT
GAACCAGAGCTTATGAAAGTGCACGTGCACTATCTGGATGCAATGGGTCCTTTTCTTAAGTATTTTCCGGATGCAGTTGG
AAGTGTCATCAATAAATTATTTGAGCTTCTCACCTCTCTTCCACACATTGTGAAGGATCCAGCTACTAGTACATCTAGAG
CTGCAAGATTGCAGATTTGTACATCTTTCATTAGAATAGCCAAAGCTGCAGAAAAAAGTGTTCTGCCTCACATGAAGGGT
ATTGCTGATACAATGGGGTATTTGGCAAAAGAAGGAACTTTACTCCGTGGGGAACATAACATTCTAGGTGAAGCATTTCT
TATTATGGCTTCCTCAGCAGGAGTTTCACAACAGCAAGAAGTTCTCGCTTGGTTATTGGAACCATTGAGTCAACAGTGGA
TCCAACCAGAGTGGCAGAACAATTATCTATCAGACCCAATGGGTCTTGTTCGTTTATGCTCCAACACATCATTGATGTGG
TCTATATTCCACACTGTTACATTCTTTGAGAAAGCACTCAAGAGAAGTGGATACAGGAAAAGCAATTTGAACAAGACCTC
TGTGACAACTCCAGCTTCACATCCTATGGCACATCATCTTTCTTGGATGTTGCCACCCCTCTTAAAACTACTCCGTGTGC
TTCATTCCCTTTGGTCTCCCTCTGTAATTCAAATATTACCCCCAGAACTTAAGGCAGCAATGACAATGACTGATGCAGAA
CGATGCAGTCTCCTGGGTGAAGCAAATTCTAAATTGTCAAAAGGCGAATCTGTTTATGCTGATGGGTCTTTTGATGGAAC
TAAAGAAGGAAAAGCCGAGGCAAGTGAATCTGATATAAGAAACTGGTTGAAAGGTATCCGAGAGAGTGGATACAACGTGC
TGGGCCTATCAACAACCATCGGAGAGACATTCTTTAAATGCTTAGATGCTAACTATGTTGCGATGGCACTCATGGAAAAT
TTGCAGTCAATGGAATTCAGGCACATTCGGCTGTTTATTCATACCTATATAAGTTATATAGTCAAATCTTGTCCCGCGGA
TATGTGGGATTCATGGCTCAGAGTGCTCCTGCACCCACTGTTTATTCACTGTCAGCAAGCTCTCAGCTCATCTTGGCTGG
GTCTTCTGCACGAGGGCAGAGCAAAGGTTCCGGACTTGTTTGATATACAAAGTGGATCAGACATGAAACTTGAAGTGATG
GAAGAAAAACTATTAAGAGATTTAACTCGGGAAATTGCGACTCTCTTTTCAACAATGGCTTCTCGTGGACTAAACACAGG
AGTTCCGGTTTTGGAAAATTCAGGCCATATTGGTCGTGTGGATATGTCTACTCTCACAGATTTTCAAGCTTTCAAATCCA
ACTCTATGGTAGGTTTCCTCCTGAATCACAAAAGCTTAGCTCTACCAGCACTGCAGATCTGTTTAGAAGCCTTTACCTGG
ACAGATGGAGAAGCGACCACCAAAGTCTGTTGTTTTTGTGGTGTTGTTGTTCTTCTAGCTATACTAACAACTAACGTGGA
GCTACGAGAATTTGTTTCAAAAGATTTGTTCACTGCAGTCATCCGCGGCTTAGGCATGGAGTCTAATGCCATTATCAGCC
CTGATTTAGTTAATATATGCCGTGAAATATTTATCTACCTCTCTGACAGAGACCCAGCTCCTCGCCAGGTTTTGCTTTCG
CTCCCTTGTCTCTCTCCAAACGAGTTGCATACTTTTGAAGAAGCTGCAGCCAAAACGTCCAGTCTCAAAGAACAAAAGCA
GCTTATGAGGAGCTTGTTGTTGTTAGGTACTGGGAATAACTTAAAAGCACTTGCTGCTCAAAAAAATCTGATTAGCACAA
ATGTCACAGCAAGATCGCGTCTACCAGCAAGCGCTCCAGAAACAGTTGGAGCGAGTTTTTTGTGA