Details for Capsella Locus Carubv10016151m

Position : scaf_3 ( 5`- 8315895 .. 8317143 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016151m

Protein [Map View]
MLAIFDKNVAKTPEALQGQEGGSVCALKDGFLPNHFSSVNPGAVTINLGSSGFIACSLEKQNPLLPRLFAVVDDMFCIFQ
GHIENVPFLKQQYGLTKTATEVTIVIEAYRTLRDRGPYSADQVVRDFQGKFAFMLFDCSTKNVFLAGDADGSVPLFWGTD
AEGHLVVSDDVETVKKGCGKSFAPFPKGCFFTSSGGLRSYEHPLNELKPVPRVDSSGEVCGVTFKVDSEAKKEGVPRVGS
VQNWSQQI*

DNA
ATGTTGGCGATCTTCGACAAGAACGTGGCGAAAACCCCCGAGGCTCTACAGGGTCAAGAGGGTGGATCGGTCTGTGCTCT
TAAAGATGGGTTCTTGCCGAACCATTTCTCCTCTGTTAACCCTGGCGCTGTCACCATCAATCTCGGATCTTCTGGTTTCA
TCGCTTGCTCGCTCGAGAAACAGAACCCTCTCCTTCCCAGATTGTTTGCTGTGGTGGATGATATGTTCTGCATCTTCCAA
GGACATATAGAGAACGTTCCATTTCTTAAGCAACAATATGGACTAACCAAAACAGCCACTGAGGTCACCATTGTGATTGA
AGCCTACAGAACTCTCAGAGACCGTGGTCCGTATTCAGCCGACCAAGTTGTTAGAGATTTTCAAGGGAAATTCGCGTTTA
TGCTCTTCGACTGCTCCACAAAAAATGTCTTCCTTGCTGGGGATGCAGATGGGAGTGTTCCTCTTTTCTGGGGAACCGAT
GCTGAAGGCCATCTCGTAGTTTCTGATGATGTTGAGACTGTGAAGAAGGGTTGTGGTAAATCCTTTGCGCCATTCCCTAA
AGGGTGTTTCTTTACCTCATCTGGAGGCTTGAGGAGTTATGAGCATCCATTAAATGAGTTAAAGCCGGTACCAAGGGTAG
ACAGTTCAGGCGAGGTGTGCGGTGTAACTTTTAAAGTCGATTCCGAGGCCAAGAAAGAAGGCGTGCCTAGGGTCGGGAGT
GTCCAGAATTGGTCTCAACAAATCTGA