Details for Capsella Locus Carubv10016138m

Position : scaf_3 ( 5`- 925889 .. 927263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016138m

Protein [Map View]
MTIANFSVLLLILFISPVALAQLRVGFYSESCSDAETIVQNLVRQRFVNDPSITAALTRMHFHDCFVQGCDASLLIDPAT
TQPSPEKTAGPNGSVRGFELIDEIKTALEAKCPSKVSCSDIITLAARDSVLLAGGPNYTVPTGRRDGFVSNLEDALRILP
GPGISVEGMLGFFANKGMDVTDAVALLGAHTVGVASCGNFGDRITNFQGTGQPDPSMDPSLVTSLRNTCAAPGGFAALDQ
STPSAPFSFDNLFFSQLRLRKGILFIDQRIATDPATSDVVSQFAANNELFKRQFAIAMVKMGAVDVLTGSAGEVRRNCRV
FN*

DNA
ATGACGATTGCAAACTTTTCTGTTCTACTCTTGATTTTATTTATTTCCCCCGTTGCTTTAGCACAGCTAAGAGTCGGGTT
TTACAGTGAATCGTGCTCTGATGCAGAGACTATCGTACAAAACCTGGTCCGCCAGCGGTTTGTTAATGACCCTTCAATCA
CGGCCGCTTTGACTCGGATGCATTTTCACGACTGTTTTGTTCAGGGCTGCGACGCTTCTCTCCTTATAGACCCAGCGACG
ACTCAACCCTCACCGGAAAAAACCGCCGGCCCAAACGGCAGCGTTAGAGGGTTCGAACTGATAGACGAGATCAAGACGGC
ACTCGAAGCTAAATGCCCCTCCAAGGTCTCGTGCTCCGACATAATCACGCTCGCCGCACGTGACTCCGTGCTCTTAGCTG
GAGGACCGAACTACACGGTCCCCACAGGACGTCGTGATGGCTTTGTATCGAACCTTGAAGACGCACTGCGGATCCTCCCT
GGACCAGGCATCTCTGTCGAAGGTATGCTAGGGTTTTTCGCCAACAAAGGGATGGACGTTACGGATGCAGTGGCTCTTTT
GGGTGCGCACACGGTTGGGGTCGCTTCTTGTGGTAACTTTGGGGACCGGATCACCAACTTTCAAGGAACCGGACAGCCCG
ACCCGTCTATGGATCCGAGTTTGGTTACCAGCCTAAGGAACACATGTGCGGCTCCAGGCGGGTTCGCGGCACTAGACCAG
TCAACTCCATCAGCACCGTTTTCATTCGACAACTTGTTCTTTAGTCAGCTCAGACTGAGGAAAGGGATTTTGTTTATTGA
CCAGCGAATCGCGACCGATCCGGCCACTTCTGATGTTGTGTCTCAGTTCGCCGCCAACAACGAACTATTCAAACGTCAGT
TTGCAATCGCGATGGTTAAGATGGGAGCCGTTGACGTGCTTACTGGTTCCGCGGGTGAAGTCAGGAGGAATTGTAGAGTA
TTCAACTAA