Details for Capsella Locus Carubv10016131m

Position : scaf_3 ( 5`- 7611371 .. 7613102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016131m

Protein [Map View]
MNGLHGNNGGMHIGVPQDPLHMQYEHQGLHHIDNGDGMMDDHTDGGMDEGVETDIPSHPGNLADNRGEVVDRGIENGDQL
TLSFQGQVYVFDHVSPEKVQAVLLLLGGREVPQTLPTSLGSPHQNNRVLGLSGTPQRLTVPQRLASLIRFREKRKGRNFD
KTIRYTVRKEVALRMQRKKGQFTSAKSSNDDSASTGSDWGSSQSWAVEGSEAQKPEILCRHCGTSEKSTPMMRRGPEGPR
TLCNACGLMWANKGTLRDLSKVPPPQTPQNLPVNKNEDPNLEADQMIGVAGDMSNSQ*

DNA
ATGAATGGACTTCATGGAAACAATGGTGGAATGCACATTGGCGTACCTCAGGATCCATTGCATATGCAGTATGAACATCA
GGGCTTGCACCATATCGATAATGGAGACGGTATGATGGATGACCATACTGATGGTGGGATGGATGAAGGAGTGGAGACAG
ACATTCCTTCTCACCCTGGAAACTTAGCTGATAATCGCGGTGAAGTTGTAGACCGTGGTATTGAAAATGGAGATCAATTG
ACGTTGTCCTTCCAGGGACAAGTTTATGTTTTTGACCATGTCTCGCCTGAGAAGGTTCAAGCTGTGCTTCTACTACTTGG
TGGACGTGAAGTACCACAGACACTCCCAACATCCCTCGGATCACCTCATCAGAACAATAGGGTACTGGGTCTATCTGGTA
CTCCTCAAAGGCTTACTGTCCCACAGCGGTTAGCATCTTTGATCAGATTTAGGGAGAAACGAAAAGGGAGGAATTTTGAT
AAGACAATTCGCTACACAGTCAGGAAAGAGGTAGCCTTGAGAATGCAGCGTAAGAAAGGTCAATTCACATCGGCTAAGTC
AAGCAATGATGATTCTGCATCCACTGGATCGGATTGGGGGTCAAGCCAGAGCTGGGCCGTAGAAGGGAGTGAGGCTCAGA
AGCCAGAGATTTTATGTCGGCACTGTGGAACAAGTGAGAAGTCAACGCCAATGATGCGACGTGGACCTGAAGGGCCAAGA
ACACTTTGTAATGCATGTGGACTAATGTGGGCAAACAAGGGGACTCTTAGAGACTTATCCAAAGTCCCTCCTCCTCAAAC
ACCCCAGAATCTGCCTGTGAATAAGAATGAGGATCCAAACCTTGAGGCTGATCAAATGATCGGAGTAGCTGGTGACATGA
GCAACTCACAGTGA