Details for Capsella Locus Carubv10016127m

Position : scaf_3 ( 5`- 4869668 .. 4870470 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016127m

Protein [Map View]
MQIYRRPFETKAWQNRICPAETMVKIHPDLTTSGAGEETSSPYLTTEKESFTIWMKSLVFNTNGCTVFNSKGRIIYRVDN
YNSKSCREVYLMDLSGHVLFTLRRQKFGLFKTWEGYRSSSGTAESTSKLEYFRVKNKVFQISNKDSSSSYRVVAGSCRND
EQYCYKMVNRGASLAIEDNSGKLLAEVKRKQSRNGLKLGEDVLTMTVESQVDHSFIVGLVLANSLINCIL*

DNA
ATGCAAATATACCGACGACCTTTTGAGACAAAAGCTTGGCAGAATCGAATCTGTCCAGCGGAGACTATGGTGAAGATTCA
TCCCGATCTGACAACCTCCGGCGCTGGAGAAGAAACAAGTTCGCCGTACTTGACGACGGAGAAAGAGAGTTTCACGATTT
GGATGAAGTCGTTGGTGTTCAACACAAATGGCTGCACCGTCTTCAATTCCAAAGGAAGGATAATTTATCGTGTTGATAAT
TATAACTCTAAGAGCTGCCGTGAAGTTTATCTCATGGACTTGTCCGGTCATGTCTTGTTCACCTTACGTAGACAGAAATT
TGGATTATTTAAGACTTGGGAAGGATATAGATCATCTTCGGGAACAGCCGAATCAACATCAAAATTAGAATATTTTCGAG
TGAAAAATAAAGTTTTTCAGATTTCGAATAAAGACTCATCTTCTTCGTATAGAGTTGTTGCGGGATCGTGTAGAAACGAT
GAACAATATTGTTATAAGATGGTAAATCGCGGAGCAAGTTTGGCGATTGAGGACAATAGTGGGAAATTATTGGCAGAAGT
GAAGAGAAAACAATCGAGGAATGGTTTGAAGTTAGGGGAAGATGTTTTGACGATGACGGTGGAGTCACAAGTTGATCACT
CTTTCATCGTTGGACTTGTTTTAGCTAATAGCCTTATCAATTGTATTCTGTAA