Details for Capsella Locus Carubv10016125m

Position : scaf_3 ( 5`- 2221261 .. 2225136 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016125m

Protein [Map View]
MEVSSLKKLEQMEFSLDSVTDLSSSSVSSSSPAVATFSCVDGVTELRFLQSDPTLCFNFDLASAQLFKLGPVHFICVSDS
SSSSEEKSFSQGVNIKFKNDKDSKDFCDSFEEWKKDAVVQGSSVQNGTVSTKKSKFDNKIEASSAKMYFRYYGQLLHQQN
MLQDYVRTGTYYAAVMENRSDFAGRVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYARKLIAGNPLFAERITVIKG
KVEDIELPEKADILISEPMGTLLVNERMLESYVIARDRFMSPKGKMFPTVGRIHMAPFSDEFLFIEMANKALFWQQQNYY
GVDLTPLYGSAHQGYFSQPVVDAFDPRVLVAPPMFHMIDFTQMKEEDFYEIDIPLKFTASMCTRLHGLACWFDVLFDGST
VQRWLTTAPGAPTTHWYQIRCVLSQPLYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQSSTCKFDLK
EPYYRMSQPQAYPVAQEPSLQLQPELNTQDIQTQNDELEEELLQQLPQNPSTQL*

DNA
ATGGAGGTCTCTTCTTTGAAAAAACTGGAGCAGATGGAGTTCTCTCTAGACTCGGTCACTGATCTTTCCTCTTCTTCCGT
CTCGTCGTCCTCTCCAGCTGTAGCTACGTTTTCCTGCGTTGATGGAGTCACGGAGCTCCGATTTCTGCAATCGGATCCGA
CCCTTTGTTTCAATTTTGATCTCGCTTCAGCTCAGTTATTCAAGTTGGGGCCAGTCCATTTCATCTGTGTATCTGATAGT
TCGAGTTCTTCAGAGGAGAAATCATTCTCCCAAGGAGTCAATATCAAATTTAAAAATGACAAGGATAGCAAGGATTTTTG
TGATTCATTTGAAGAGTGGAAAAAGGATGCTGTTGTTCAAGGATCATCCGTGCAAAATGGAACAGTTTCAACTAAGAAAA
GCAAGTTTGACAATAAGATAGAGGCGTCCTCGGCAAAAATGTATTTCCGTTATTATGGACAACTTCTACATCAACAAAAT
ATGCTTCAAGATTATGTGAGGACAGGTACATATTACGCTGCAGTCATGGAGAATCGTTCAGATTTTGCTGGTCGTGTTGT
GGTCGATGTGGGTGCTGGGAGTGGCATTTTGTCAATGTTTGCTGCCCAGGCTGGTGCCAAGCATGTGTATGCGGTTGAAG
CATCAGAAATGGCTGAGTATGCACGTAAGCTGATTGCTGGAAACCCATTGTTCGCTGAACGGATCACAGTCATCAAGGGT
AAAGTTGAGGACATCGAGTTGCCTGAGAAAGCAGATATTTTGATATCTGAACCGATGGGCACCTTATTGGTCAATGAGAG
AATGTTAGAATCATATGTAATAGCTAGGGATCGTTTTATGTCTCCAAAGGGCAAAATGTTTCCCACTGTCGGAAGGATTC
ACATGGCACCTTTTTCCGATGAATTCTTATTTATTGAGATGGCAAATAAGGCTTTGTTTTGGCAGCAGCAAAACTATTAT
GGAGTTGATCTGACACCTCTATATGGATCAGCACACCAAGGTTATTTTTCTCAGCCCGTGGTTGATGCATTTGATCCGAG
AGTATTAGTGGCTCCTCCGATGTTTCACATGATAGATTTCACTCAAATGAAGGAAGAAGATTTTTACGAGATTGATATCC
CATTGAAATTCACGGCTTCCATGTGCACCAGATTGCATGGACTTGCCTGCTGGTTTGACGTTCTCTTCGACGGGAGCACG
GTCCAAAGATGGCTCACAACTGCTCCTGGTGCACCTACAACACATTGGTACCAAATCAGATGTGTTCTCTCGCAGCCTCT
TTACGTAATGGCAGGTCAAGAGATCACTGGTAGACTTCATTTGATAGCCCACAGTGCTCAGAGTTACACCATAGATCTAA
CTTTGTCAGCTAAAATGTGGGGTCCCGGTGCAAGTCAAGGCGGAATTCTCCAATCATCAACATGCAAATTCGATTTGAAA
GAACCATATTATAGAATGTCTCAGCCACAAGCATACCCTGTCGCACAAGAACCATCACTACAACTACAACCGGAGCTAAA
TACACAGGACATACAAACACAAAACGATGAATTAGAAGAAGAGTTACTGCAACAACTGCCACAGAATCCGAGTACCCAGC
TCTAG