Details for Capsella Locus Carubv10016123m

Position : scaf_3 ( 5`- 9378573 .. 9387517 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016123m

Protein [Map View]
MHGSVSGYLLVNAEVDSMGGVIDSGGGIGVKTSPRRTAIEKAQAELRQEYDVREERRRELEFLEKGGNPLDFKFGIATSH
SVQSTSLTDQQTEHFVNSEVKDRFALTASPNGDSVESSGRPGVPSISEPNTADNLLLFDSENKSVEGERNLRYPNRQNRT
SETERSSKANTNQNTKETEDSAIFRPYARRNRSKINRDPSRSSSTDLVQSRAGLVTSISVRRGSVEGKGCIPEAANQKDK
HTTSVSCPIFANSNGIVPKNIVPSNSLNTKVDCEPVLRESTSGSKTSLDEANITYRKSSAHLPVGVSGLAGEKAQLVSTD
TEIGSPKAVTIAGQENNSTQLNGLRNSTGEEESLTNRGAAGTKGLESESSLANNVDVDNERDLYKVDKPDSDEISMQKAL
RVEGLLNQTVDEITKTKIEDETGRPTTIISESIPEKLVKIENQSHRSTAAMQNEEKVSETEKRLQDGLVVPEIDRKVVIL
PENLSSSLCFEIPQASVDTSSCAVGDNLLSGTDFEALKPSSNAVVLDTMKEDSILEEARIIQTKRKRIAELSCGTAPVEV
REKCQWDFVLEEMAWLANDFAQERLWKLTAAAQICHRVALTCQLRFEERNQHKKLKKIASILSSAILQFWSSVEGPGELE
ETSLGIVKDTCQESNCVNGRICLAAGVKEYASRFLKYNNSSIPYHSAAPLTPDNMCDPEILDILMLDQLTEASLFYSVPS
GAMEVYHKSIESHLTHCEKSGSSMQEEVDTSAYDAAGDTGYNGAAFEEDEGETSTYYLPGALESSKSFNKSHKKRKNLMK
SHSARSYDLGDDLPYGNYTGGSNSSSVMAKRPASNNNLGSVPTRRVRTASRPRNASPFGCATIAENLPVPSKTDVSSGDT
SSFQDEQSSLHGGSAAQKGTEVESSGNFEKQLPYDMAETSGKPKKKKKTHQGSAYDQTWHDPSVHIEQKDHWKKRPENHF
DMNGLYGPHSAKKQKTTKQLVENNFDIAIPHTGSIPSPAASQMSNMSNPNKSIKFIGGRDRGRKVKSLKISPGQHGSGNL
WSLFEDQALVVLVHDMGPNWELISDAMNSTLKIKCIYRNSTECKERHKILMDRNAGDGADSAEDSGNSQSYPSTLPGIPK
GSARQLFQRLQGPMEEDTLKSHFEKICLIGKKLHYKKTQNDGRDPKQIVPVHNSQVMALSQVFPNNLNGGVLTPLDICDA
STSGQDVFSLENPGLPVLNQGTPVLPTAGAHPSTPGSSGAVLNNNLPTTSGLQSASVSDGRFNVPRGSLPLDEQNRIQQF
NQMLSGRNLQQPSVSTPGAVSGSDRGHRMVPGGNAMGANGMNRSTPMSRPGFQGMGSSAMPNTTSMLSSGMVGIPNTGNI
HSGGGASQGNSMLRPREAMQHVMRAAQGNSPGIPAFGNLSSGFTNQTTPVQAYPGHLSQQHQMSPQSHVLGNSHHPHHQI
PSQATGAQQEAYAIHQRQIRQRILQQQQQQQQFPASGTMMPHVQQPQGSSVSSSPQNSPQTQPPVSPQPLSMSPVSTSPN
MNTLAQQNPQKSQLPLHGIGRSPHSGASGVSNQAGKQRQRQLLQQSARQHPQQRQPTQGQQQSKQLKGMGRGNMIHQNIT
VDQSHLNGVTMTPGNQATEKGGQAVPVRPDQQSNAGTAMSTHLQSKPFVYPLSSNHSQQLPKALPGASTPSQQQQMQLHL
DNSIQGQSSPAAPCNILPTSGPSVTPSNHQHLLLHQKQRNQLQSTAQRVIHHNHLGNSELSKKSQAERISRVPHSVTNTI
QIASMGTTKGMPQSSHDSKNVKAVGSTVVPALESPSSATSMQSTASKVVNSSNTDSAGNDPVTAPNQGLAQKHVSGGLPS
HGIKAVTQRQQSLPSEEKRPKLSEKLPVQNQKHLASEQQQQPQLEEAQVSASKPPDTKVE*

DNA
ATGCATGGAAGCGTTTCAGGGTATCTTCTAGTAAATGCTGAGGTTGATTCCATGGGAGGAGTTATTGATAGTGGAGGTGG
TATTGGTGTCAAAACATCTCCGCGCCGAACAGCAATTGAGAAGGCTCAAGCGGAGCTAAGGCAAGAGTATGATGTCCGTG
AGGAAAGGAGGAGAGAACTAGAGTTTCTGGAGAAAGGCGGTAATCCCTTGGATTTCAAGTTTGGCATTGCAACTTCACAT
AGCGTCCAATCTACATCACTCACAGATCAGCAAACGGAGCATTTTGTAAACAGTGAAGTCAAGGATAGGTTTGCCCTGAC
TGCCTCACCAAATGGAGACTCTGTGGAGAGTAGCGGTAGACCTGGAGTTCCTTCCATTTCTGAACCCAATACAGCAGATA
ATCTTTTACTGTTTGATTCTGAAAACAAGTCAGTGGAAGGAGAAAGAAATTTGAGATATCCTAATAGGCAAAACAGAACT
TCTGAGACAGAACGATCTTCCAAAGCAAATACCAACCAGAATACAAAAGAAACAGAAGATTCTGCCATCTTTCGCCCGTA
TGCTCGGAGGAACAGATCAAAGATAAATCGGGATCCATCACGGTCAAGTTCTACGGATTTAGTTCAGAGTCGTGCTGGTC
TTGTAACATCTATATCTGTTCGCAGAGGATCAGTGGAAGGAAAGGGTTGCATTCCCGAAGCAGCGAATCAAAAAGATAAG
CATACGACTTCCGTATCTTGTCCAATATTTGCAAATTCGAATGGGATTGTTCCAAAAAATATAGTTCCCAGCAATTCGCT
GAATACTAAGGTGGATTGTGAACCTGTTTTACGAGAGAGTACTTCTGGATCTAAGACTAGTCTAGATGAAGCCAACATTA
CATACAGAAAAAGCTCAGCACATTTGCCCGTTGGAGTGTCTGGCCTTGCTGGGGAGAAGGCACAACTAGTTTCGACTGAT
ACAGAGATTGGTTCTCCCAAAGCTGTAACAATAGCTGGCCAGGAAAATAATTCTACCCAACTGAACGGCCTAAGAAATTC
CACGGGAGAGGAAGAAAGCTTAACAAATAGAGGAGCTGCAGGGACTAAAGGGTTAGAGTCAGAGTCTTCTCTCGCTAACA
ACGTAGATGTAGATAATGAAAGAGATCTTTATAAAGTGGACAAACCTGACTCAGATGAAATCTCTATGCAGAAGGCTTTG
AGAGTAGAGGGTTTGCTTAATCAAACAGTTGATGAAATAACGAAAACTAAGATTGAGGATGAGACAGGTCGACCTACTAC
CATTATTAGTGAGAGCATTCCTGAGAAATTGGTTAAAATTGAAAATCAAAGTCACAGAAGTACAGCTGCGATGCAAAATG
AAGAGAAAGTTTCTGAGACTGAGAAAAGGCTTCAAGATGGGTTGGTTGTACCGGAAATTGACAGGAAAGTTGTCATTTTA
CCTGAAAATCTTAGCAGCTCGTTGTGCTTTGAAATTCCTCAGGCATCTGTAGACACAAGTTCCTGTGCAGTCGGCGATAA
TTTATTGTCAGGAACTGACTTTGAAGCATTAAAGCCAAGCTCAAATGCAGTAGTGTTAGATACTATGAAAGAGGACTCTA
TCCTTGAGGAGGCACGGATTATACAGACAAAGAGAAAAAGAATTGCCGAGTTATCTTGTGGTACTGCACCAGTGGAGGTC
CGTGAGAAATGTCAATGGGATTTTGTCCTCGAAGAAATGGCATGGCTGGCAAATGATTTTGCGCAGGAGCGCCTTTGGAA
GCTGACTGCTGCTGCACAAATTTGCCATCGAGTTGCTTTGACTTGTCAGTTGAGATTTGAAGAACGAAATCAGCACAAAA
AGCTGAAAAAAATAGCTTCAATCCTATCTAGTGCTATCTTGCAGTTCTGGAGTTCTGTGGAGGGTCCTGGGGAGCTGGAG
GAGACAAGCTTGGGAATTGTTAAGGACACTTGCCAAGAATCTAATTGTGTGAATGGCAGAATATGTTTAGCTGCGGGTGT
CAAGGAGTATGCAAGTAGATTTTTGAAGTATAACAACTCTTCCATCCCCTATCATTCAGCTGCACCGTTAACACCTGACA
ATATGTGCGACCCAGAAATATTGGATATATTAATGCTTGATCAGCTTACAGAAGCAAGCCTCTTTTATTCAGTTCCATCT
GGTGCAATGGAGGTATACCATAAGTCCATTGAGTCGCATCTTACACACTGCGAGAAATCTGGAAGTAGCATGCAGGAGGA
GGTTGATACATCGGCTTATGATGCTGCTGGAGATACAGGATATAATGGTGCTGCATTTGAGGAGGATGAAGGAGAAACAA
GTACCTATTATCTTCCGGGAGCTTTGGAATCTAGCAAATCATTTAATAAAAGCCACAAAAAAAGGAAGAATCTGATGAAG
TCTCATTCTGCCCGGTCATATGATCTTGGAGATGATTTACCATACGGCAACTACACAGGTGGGTCTAACTCATCAAGCGT
GATGGCAAAAAGGCCTGCCAGTAATAATAATCTTGGCTCAGTTCCGACGAGGAGAGTGCGCACTGCTTCCAGGCCGAGGA
ATGCGAGTCCTTTTGGCTGTGCTACTATTGCTGAGAATTTACCTGTGCCCTCGAAGACGGATGTGTCTAGTGGAGATACT
AGTTCTTTCCAGGATGAGCAAAGTAGTTTACATGGTGGATCGGCAGCCCAAAAAGGGACAGAGGTTGAATCAAGTGGTAA
TTTTGAAAAGCAGTTACCTTATGACATGGCTGAAACCTCAGGAAAACCTAAAAAGAAGAAGAAGACTCATCAGGGATCTG
CATATGACCAAACCTGGCATGATCCGTCAGTCCATATCGAACAGAAGGACCACTGGAAGAAGCGACCAGAGAATCATTTC
GATATGAACGGTCTGTATGGTCCTCATAGTGCAAAGAAGCAAAAGACCACCAAGCAATTGGTAGAGAATAATTTTGATAT
TGCTATTCCTCACACTGGCTCTATTCCTTCTCCAGCGGCTTCCCAGATGAGTAATATGTCCAACCCCAACAAATCTATCA
AATTTATTGGAGGTCGTGATAGGGGCAGAAAAGTAAAAAGCCTGAAGATTTCCCCTGGCCAGCATGGTTCTGGAAATCTG
TGGTCATTATTTGAGGATCAGGCGCTTGTTGTCCTGGTGCATGATATGGGCCCTAACTGGGAGCTCATTAGTGATGCCAT
GAACAGCACTCTTAAAATTAAGTGTATATATCGCAATTCGACTGAGTGCAAGGAGCGGCATAAGATTCTGATGGATAGGA
ATGCTGGTGATGGTGCTGATAGTGCTGAAGATTCAGGGAATTCTCAGTCTTATCCATCCACTTTGCCTGGCATCCCAAAG
GGAAGTGCGAGACAGTTGTTTCAACGACTGCAAGGGCCAATGGAGGAAGATACCCTGAAGTCTCATTTTGAGAAGATTTG
TTTGATTGGGAAGAAGTTACATTATAAAAAGACTCAGAATGATGGTCGGGATCCCAAACAAATAGTACCAGTTCACAATT
CACAAGTCATGGCTCTTTCTCAAGTATTCCCAAATAATTTGAATGGAGGTGTTCTAACGCCTCTTGATATCTGTGATGCA
TCAACTTCAGGTCAAGATGTATTTTCACTTGAAAATCCAGGTCTTCCAGTGTTGAATCAGGGTACGCCAGTGCTCCCTAC
TGCTGGAGCACATCCATCCACTCCTGGATCATCTGGTGCCGTTCTCAACAACAATTTGCCAACCACATCTGGCCTACAGA
GTGCTTCTGTCAGTGATGGTAGATTCAACGTTCCTAGAGGGTCTTTGCCACTTGATGAACAAAACCGAATACAACAGTTT
AACCAGATGTTATCCGGTAGAAACCTGCAGCAGCCTTCTGTATCAACTCCTGGAGCTGTCTCAGGATCTGATCGTGGACA
TCGCATGGTTCCTGGTGGAAATGCTATGGGTGCAAATGGAATGAACAGGAGCACACCCATGTCAAGGCCTGGTTTTCAAG
GGATGGGATCCTCAGCAATGCCAAATACTACTAGTATGCTTTCTTCTGGTATGGTAGGAATTCCAAACACTGGAAATATT
CATTCCGGAGGAGGAGCTTCTCAAGGAAACTCCATGCTCAGGCCTCGTGAAGCTATGCAGCATGTGATGCGGGCTGCTCA
AGGGAATAGTCCAGGGATCCCAGCTTTCGGTAATTTGAGTTCTGGATTTACCAACCAGACAACTCCTGTTCAGGCTTACC
CAGGCCATCTTTCCCAGCAGCATCAGATGTCACCGCAGTCACATGTGCTTGGGAATTCGCATCATCCTCATCACCAGATC
CCAAGTCAAGCCACTGGGGCACAGCAGGAAGCATATGCAATCCATCAAAGGCAAATACGCCAGAGGATTTTGCAGCAACA
GCAACAGCAACAACAGTTTCCAGCATCTGGTACAATGATGCCACATGTACAACAACCTCAGGGCTCTTCTGTTTCTTCTT
CTCCACAAAATAGTCCTCAGACTCAACCACCAGTTTCTCCCCAGCCATTATCGATGTCCCCAGTGTCGACTTCTCCTAAC
ATGAATACTTTGGCACAACAGAACCCTCAAAAGTCTCAGTTACCGCTTCATGGTATAGGTAGGAGTCCTCATTCTGGTGC
TTCTGGTGTGAGCAATCAAGCTGGAAAACAACGGCAGCGGCAACTTCTGCAGCAGTCTGCGAGACAACATCCACAGCAGC
GGCAGCCAACACAAGGTCAACAGCAGAGTAAACAGTTGAAGGGGATGGGTAGAGGCAACATGATCCATCAGAACATCACT
GTTGATCAGTCACACCTGAATGGTGTCACCATGACCCCAGGAAATCAGGCTACCGAAAAAGGAGGGCAAGCGGTTCCAGT
TAGGCCTGATCAGCAGTCTAATGCAGGGACTGCCATGAGCACGCATCTGCAATCTAAACCATTCGTTTATCCCTTGTCTT
CAAATCATTCACAGCAATTGCCTAAAGCATTACCTGGTGCTTCGACTCCGTCCCAACAACAACAGATGCAATTACATTTA
GATAATAGCATCCAAGGCCAGAGCTCCCCTGCGGCCCCATGTAACATCTTACCCACCTCTGGCCCCTCAGTTACACCTTC
TAACCATCAGCATTTGTTGCTACACCAAAAGCAGCGCAATCAACTGCAATCAACAGCTCAGCGAGTTATTCATCATAATC
ATCTAGGGAACTCTGAGTTATCAAAGAAGTCTCAAGCTGAACGTATTTCACGTGTTCCGCACTCTGTCACCAATACCATC
CAAATTGCTAGTATGGGTACGACAAAGGGTATGCCTCAATCGAGTCATGATTCGAAAAACGTTAAAGCAGTTGGTTCTAC
AGTTGTGCCTGCTTTAGAATCTCCATCTTCTGCTACCTCCATGCAAAGCACTGCTTCTAAAGTAGTAAACAGCTCCAATA
CAGATTCAGCTGGGAATGATCCAGTAACAGCACCGAATCAAGGACTAGCTCAGAAGCATGTATCTGGTGGCTTGCCGAGT
CACGGGATCAAGGCCGTCACACAGAGACAACAGTCTCTGCCTTCAGAAGAAAAGAGACCAAAGTTGTCAGAGAAGCTGCC
TGTACAAAATCAGAAACACCTTGCTTCTGAGCAGCAGCAGCAGCCTCAATTAGAAGAAGCACAAGTATCAGCTTCCAAGC
CCCCTGATACGAAAGTGGAATGA