Details for Capsella Locus Carubv10016118m

Position : scaf_3 ( 5`- 5416060 .. 5418861 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016118m

Protein [Map View]
MFQSNGASGEEYPDFKWGAKRGVGRKDSKVRFYESFTYEGIEYRLFDCAYFYVCGQCETSIGKLVSMYETSAGEKKVKVI
WFFRPIDIHRFLGEYEPQWDELFLACGDEKGVTNINDVETIMGKCNVVCISKDRRNPPPERNELRKANYVFSRTFDTRLK
IISKIFADAIAGIGVEKIFNRIRDKQPVKRLNSSAAASSRTSPVKKNHPDLGSTKLEKENNRDGKLTSRTSSGKKVSFLE
ERADHVHVKKNPLVNTDTMPRGPITKTRAFGELHASGSLVDAKPSKKRKLILNTPETDDSDDSGPQLGETKFIKNPPLVE
KAPSQNIKKSSWYKKLPFEEELKAAIETSRVLLIENLEPSYTSLEVEELCRKAFNEGVDAKMIPSSLMSSPLSGRALVIF
GTAKAADSAMARLTEECLMLPGQRALMGSRKVPEEIGKLRSFTGHFSLLDRSMMTAQK

DNA
ATGTTTCAATCCAATGGTGCCAGTGGAGAAGAGTACCCTGATTTTAAATGGGGTGCTAAGAGAGGGGTGGGACGGAAAGA
TAGTAAAGTCCGGTTCTATGAATCATTTACCTATGAGGGCATCGAGTACCGGCTTTTTGACTGTGCTTATTTTTATGTAT
GTGGTCAATGTGAGACTTCAATTGGGAAGCTTGTCAGCATGTACGAGACATCAGCAGGTGAGAAGAAAGTAAAGGTCATT
TGGTTCTTTCGACCTATTGACATCCATCGCTTCTTGGGAGAGTATGAGCCACAATGGGATGAGTTGTTTCTGGCTTGTGG
TGATGAAAAAGGGGTAACCAATATCAACGATGTGGAGACGATCATGGGGAAATGCAATGTTGTATGCATATCGAAGGACC
GAAGAAACCCACCACCAGAAAGAAATGAGCTGAGGAAAGCTAACTATGTCTTCTCCCGCACCTTCGATACAAGGCTGAAA
ATTATATCAAAAATCTTTGCAGATGCAATAGCTGGAATTGGAGTGGAGAAAATTTTCAACAGAATAAGGGATAAGCAGCC
TGTAAAACGTCTAAACTCAAGCGCAGCTGCCAGTTCCAGGACTTCTCCAGTAAAAAAAAATCATCCAGATTTGGGATCAA
CAAAGTTAGAAAAAGAAAATAACAGAGATGGAAAGCTGACGAGTAGAACAAGCTCGGGAAAGAAAGTCTCTTTTCTGGAG
GAACGTGCTGATCATGTACATGTGAAGAAGAACCCTCTTGTCAATACTGATACCATGCCAAGAGGTCCCATAACCAAAAC
CAGAGCATTTGGGGAGTTACATGCTTCAGGTTCATTAGTCGATGCTAAGCCTTCTAAAAAGAGGAAGCTTATACTCAACA
CGCCAGAAACAGATGATTCAGATGATTCAGGCCCTCAACTAGGAGAGACGAAATTCATTAAAAACCCTCCTCTTGTAGAA
AAAGCTCCAAGTCAGAACATCAAGAAAAGCAGCTGGTACAAGAAACTGCCTTTTGAGGAAGAACTAAAAGCGGCTATAGA
AACAAGTAGGGTGCTCTTAATTGAGAACCTGGAACCATCATACACATCGCTGGAGGTAGAGGAACTTTGTAGGAAAGCTT
TCAATGAAGGAGTTGATGCTAAGATGATCCCTTCTAGTCTCATGTCTAGTCCACTTAGTGGCAGGGCTCTTGTGATTTTT
GGAACCGCAAAGGCAGCTGATTCTGCTATGGCGCGGTTAACTGAAGAGTGCCTGATGTTACCTGGCCAGAGAGCTCTAAT
GGGAAGCAGAAAAGTTCCAGAAGAAATTGGAAAACTTAGAAGCTTTACTGGCCATTTTAGCTTGCTAGATAGATCTATGA
TGACAGCTCAGAAG