Details for Capsella Locus Carubv10016115m

Position : scaf_3 ( 5`- 1602361 .. 1603462 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016115m

Protein [Map View]
MDPKSSDSERKDGCISETQSIETTEDDSCLLGKRKVETTTSTPEDLSENEGDIESVVDEDIYSDSDLEWDKDSFDGREYH
SSQDDSEVFFVSTNKFPPFLWAGIATVPGMDDKLEEGLTVRQFLANMTCLCVDKYNKGKGFNVKFEQVLRANFNPGGPDA
PLLEYQAKVVWSAGKIYPILCRPTPPSNIYGRGGQLKEASKLMEESN*

DNA
ATGGATCCCAAATCAAGCGACAGCGAGAGGAAGGATGGATGTATAAGCGAAACCCAATCGATAGAGACCACCGAAGATGA
CTCTTGTTTGCTGGGGAAGCGCAAGGTTGAAACCACCACGTCCACGCCGGAGGATCTCAGTGAAAACGAAGGCGACATAG
AAAGTGTCGTCGATGAGGATATTTATAGTGATAGTGATTTAGAATGGGACAAGGATAGCTTCGATGGACGGGAGTATCAT
TCCTCTCAAGATGACAGCGAGGTTTTTTTTGTGTCAACTAACAAGTTCCCACCTTTCCTCTGGGCTGGAATTGCTACAGT
CCCGGGTATGGACGATAAACTTGAAGAAGGTTTGACCGTTCGCCAGTTTCTAGCAAACATGACATGTCTATGTGTTGATA
AATATAACAAAGGAAAGGGATTTAATGTGAAGTTCGAGCAAGTCTTGAGAGCCAATTTCAACCCAGGGGGCCCTGATGCA
CCTCTATTGGAGTATCAAGCTAAAGTTGTATGGTCAGCTGGCAAGATTTATCCCATCCTTTGCAGACCAACTCCACCTTC
AAATATATATGGTCGAGGAGGTCAATTGAAAGAGGCATCCAAGCTGATGGAAGAGAGCAATTGA