Details for Capsella Locus Carubv10016114m

Position : scaf_3 ( 5`- 3664401 .. 3664853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016114m

Protein [Map View]
MKKVSQLSIIFRDELQNLNKDSDVVGKKPSNSSSDNDCNQFASLFASWSSSSFQMPLQYPKYTKEQYEIMSEDELDRLLS
LYGLPIDVGDLSYKKEFAVGAFLWETGMKSPLDEHDSVNPNSSIGDLDASSLMGLMTVLIKDMVQLIFRV*

DNA
ATGAAAAAGGTTTCACAACTTAGCATTATCTTCCGTGACGAACTACAAAATCTCAACAAAGACTCTGATGTCGTCGGGAA
AAAACCATCTAATTCATCGTCGGACAATGATTGCAACCAATTCGCCAGCTTGTTTGCTTCTTGGTCATCGTCTTCGTTTC
AAATGCCTCTTCAGTACCCGAAATACACAAAGGAACAGTACGAGATAATGTCGGAGGATGAACTAGATCGACTTCTCAGT
CTCTATGGTCTGCCTATAGATGTCGGTGACTTGTCCTACAAAAAAGAATTTGCAGTCGGTGCATTCTTGTGGGAAACGGG
GATGAAGTCTCCACTGGATGAGCATGATTCAGTAAACCCTAATTCTTCCATCGGTGATTTGGATGCAAGCTCTTTGATGG
GATTGATGACAGTTCTAATAAAAGATATGGTTCAATTAATTTTTCGTGTGTAG