Details for Capsella Locus Carubv10016113m

Position : scaf_3 ( 5`- 5283433 .. 5284263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016113m

Protein [Map View]
MQIHKLCFLVLFLANAAFAVKFNFKSFDGNNLVFLGDAELGASSDGVGRSGALSMTRDENPFSHGRGLYINPIPFKPSNT
SSPFSFETSFTFSITPRTKPNSGQGLAFVIVPEADNSGASGGGYLGILNKTNDGKPENHIFAVEFDTFQNDEFMDISGNH
VGVNINSMTSLVAEKAGYWVQTLVGKRKVWSFKDVNLSSGERFKAWIEFRSKDSRITVTLAPENVKKPKKPLLQGPRVLN
DVLLQNMYAGFAGSMGRAVERHDIWSWSFENAAKNN*

DNA
ATGCAGATTCACAAACTCTGTTTTCTTGTTCTGTTCCTAGCTAACGCAGCTTTCGCCGTCAAGTTCAACTTCAAATCCTT
TGATGGCAACAACTTGGTGTTCCTCGGAGATGCGGAGCTCGGTGCTTCCTCTGATGGTGTAGGGAGATCCGGAGCTCTAT
CCATGACCCGAGACGAGAACCCTTTCTCTCACGGTCGAGGTCTTTACATCAATCCTATCCCATTCAAGCCTTCAAACACT
TCTTCTCCTTTCTCGTTTGAAACTTCTTTCACTTTCTCCATCACCCCTCGTACCAAACCCAACTCCGGTCAAGGCCTTGC
CTTCGTCATCGTCCCTGAAGCTGATAACTCCGGCGCTTCCGGTGGCGGGTATCTCGGAATCCTCAACAAAACCAACGACG
GGAAGCCAGAAAACCACATCTTCGCTGTCGAATTCGACACTTTCCAGAACGATGAGTTCATGGACATTAGTGGTAACCAT
GTCGGAGTCAACATCAACTCGATGACTTCTCTTGTCGCTGAGAAAGCTGGTTACTGGGTTCAGACATTGGTCGGGAAAAG
AAAGGTTTGGTCGTTTAAAGATGTGAATCTGAGCAGTGGAGAGAGGTTCAAGGCTTGGATCGAGTTCAGAAGCAAAGACT
CTAGGATCACCGTTACGCTGGCGCCAGAAAACGTTAAGAAACCGAAGAAGCCTTTGCTCCAAGGTCCGAGAGTCCTCAAT
GACGTCCTTCTTCAAAACATGTACGCCGGCTTTGCTGGTTCCATGGGACGTGCCGTTGAGCGTCACGACATTTGGAGCTG
GTCCTTCGAAAACGCAGCCAAAAACAACTAA