Details for Capsella Locus Carubv10016111m

Position : scaf_3 ( 5`- 13500516 .. 13503334 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016111m

Protein [Map View]
MVLYSSCRIMYLGLILLLSSSWVLDRCEGFGEFGFEFHHRFSDQVVRALPGDGLPNRDSSKYYRVMAHRDRLIRGRRLAS
VDQSLVTFSDGNETVRVDALGFLHYANVSIGTPSDWFLVALDTGSDLFWLPCDCTNCVRELKAPGGSSLELNIYSPNVSS
TSSKVPCNSSLCTRGDRCASPQSNCPYQIRYLSNGTSSTGVLVEDVLHLVSNDKSSKTIPARVTLGCGQVQTGVFHDGAA
PNGLFGLGLEDISVPSVLAKEGIAANSFSMCFGTDGAGRISFGDKGSVDQRETPLNIRQPHPTYNITVTKISVGGNVGDL
EFDAVFDSGTSFTYLTDAAYTLISESFNSLALDKRYQTTDSDLPFEYCYALSANKDSFQYPAVNLTMKGGSSYPVYHPLV
VIPMKDTDVYCLAIMKIEEISIIGQNFMTGYRVVFDREKLVLGWKESDCYTGETSARTLPSNRSSASARPPTSSYEPEAT
NIPSQRSNTSTSSAYSISISLSLFFFSILAFFI*

DNA
ATGGTTTTGTACTCAAGCTGTAGAATTATGTATCTGGGTCTGATTCTTTTGTTGTCTTCGAGCTGGGTTTTGGATAGATG
CGAAGGATTTGGTGAATTTGGGTTTGAATTTCATCACCGTTTCTCGGATCAGGTTGTTAGGGCTTTGCCTGGAGATGGTT
TGCCTAATCGAGACTCGTCTAAGTATTACAGAGTGATGGCTCATCGTGATCGGTTAATTAGAGGTCGTAGGCTTGCTTCT
GTTGATCAATCACTTGTTACTTTCTCTGACGGCAACGAAACTGTTCGTGTTGATGCTTTAGGATTTTTGCATTACGCTAA
TGTGTCGATTGGGACGCCGTCTGATTGGTTTCTGGTTGCTTTAGACACTGGAAGTGACTTGTTTTGGTTGCCCTGTGACT
GCACCAATTGTGTTCGTGAATTGAAAGCGCCTGGTGGCTCGAGTTTGGAACTTAATATTTATAGCCCTAATGTATCATCA
ACAAGTTCTAAAGTTCCTTGTAATAGCTCGTTATGTACAAGAGGGGATCGATGCGCTTCCCCTCAAAGTAATTGCCCATA
CCAGATCCGGTATCTTTCTAATGGTACCTCGTCTACTGGAGTCTTGGTAGAGGATGTACTTCACTTAGTTTCAAATGACA
AAAGTTCCAAAACTATTCCCGCTCGAGTTACTTTGGGATGTGGTCAAGTTCAGACTGGTGTATTCCATGATGGTGCAGCT
CCAAATGGTCTTTTCGGGCTTGGCTTAGAAGACATATCGGTTCCTAGCGTACTAGCAAAGGAAGGAATTGCAGCAAACTC
ATTCTCAATGTGTTTTGGGACTGATGGAGCTGGTAGGATCAGTTTTGGAGATAAAGGTAGTGTAGACCAACGGGAAACGC
CATTGAACATAAGACAACCACATCCTACTTACAACATCACTGTCACTAAAATAAGCGTTGGAGGAAATGTTGGTGATCTT
GAATTTGATGCTGTTTTCGACTCTGGAACCTCGTTCACTTATCTGACTGATGCAGCTTACACCCTTATTTCAGAAAGTTT
TAATTCTTTAGCTCTGGACAAACGCTACCAAACAACTGATTCAGACTTACCTTTTGAGTACTGTTATGCATTAAGCGCAA
ACAAAGACAGCTTCCAGTATCCAGCTGTGAATCTTACGATGAAAGGCGGGAGCTCATATCCCGTTTATCACCCGTTAGTA
GTAATCCCCATGAAGGACACAGATGTCTACTGTTTAGCCATCATGAAGATAGAAGAGATTAGCATCATCGGACAGAACTT
CATGACTGGCTACCGCGTTGTTTTTGATCGTGAGAAACTGGTACTGGGGTGGAAAGAATCTGATTGTTACACAGGTGAGA
CCTCAGCTCGGACGCTTCCATCAAACCGTTCCTCAGCCTCGGCTAGACCGCCAACTTCTTCGTATGAACCAGAGGCTACA
AACATACCATCTCAAAGATCAAACACGTCGACGTCTTCTGCTTATTCTATCTCTATCTCTCTTTCATTATTCTTCTTCTC
AATTTTGGCCTTCTTCATTTGA