Details for Capsella Locus Carubv10016106m

Position : scaf_3 ( 5`- 6145822 .. 6147185 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016106m

Protein [Map View]
MNGKASVSKELNAKHSKILEALLKHPDNRECADCRSKAPRWASVNLGIFICMQCSGIHRSLGVHISQVRSITLDTWLPDQ
VAFMQSTGNAKANRYWESELPPHFERSSSDTFIRAKYNEKKWVSRGGIQPAPVVSKLSKVSHLVESGYKPETPKKARTLS
LDEEILLNHVLQVTPPEIRIRAGSVDMKENVYVLPLPVIEVKKPNQKNEIFSSELNHNRRTTIAPPSSWATFD

DNA
ATGAACGGGAAGGCCTCTGTTTCCAAGGAGCTCAACGCCAAACATTCCAAGATATTGGAAGCACTTTTGAAGCACCCAGA
CAATCGAGAATGTGCAGATTGTAGATCAAAGGCACCAAGATGGGCAAGTGTGAACCTTGGGATATTCATTTGTATGCAAT
GCTCTGGAATCCATCGTAGCCTCGGCGTCCACATCTCACAGGTACGGTCTATAACTCTGGATACATGGCTTCCAGATCAG
GTTGCTTTCATGCAATCTACGGGTAATGCTAAGGCCAATCGGTATTGGGAATCAGAATTGCCTCCTCATTTCGAGAGAAG
TTCAAGCGACACGTTTATAAGAGCCAAATACAATGAGAAGAAATGGGTTTCACGGGGAGGGATTCAACCGGCTCCTGTAG
TTAGTAAGCTAAGCAAAGTTAGTCACTTGGTAGAGAGCGGATATAAGCCTGAAACTCCAAAGAAAGCTAGAACTCTTTCA
CTTGACGAAGAGATCCTTCTTAATCATGTTCTTCAAGTAACACCTCCAGAAATAAGAATTCGTGCGGGTTCAGTAGATAT
GAAGGAGAACGTATATGTTCTACCTCTACCAGTGATAGAGGTCAAAAAACCAAATCAAAAGAATGAGATTTTCTCCAGCG
AGTTGAATCATAATAGAAGAACCACCATAGCACCACCCTCGAGCTGGGCGACATTCGAC