Details for Capsella Locus Carubv10016092m

Position : scaf_3 ( 5`- 6128381 .. 6129127 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016092m

Protein [Map View]
MDFSNSCSSFSSSSVDSTKPSPSESSVNLSLSLTFPSTSPQREARQDWPPIKSRLRDRLRGRRLLCRGDDTSLFVKVYME
GVPIGRKLDLCAFSGYESLLENLSHMFDTSIICGKRDRKHHVLTYEDKDGDWMMVGDIPWDMFLENVRRLKITRPERY*

DNA
ATGGATTTTTCTAACTCTTGTTCTTCATTCTCTTCATCTTCTGTCGATAGTACTAAACCTTCTCCTTCAGAATCTTCTGT
AAATCTCTCCCTTAGCCTCACCTTTCCCTCTACTTCTCCACAAAGAGAAGCAAGACAAGATTGGCCACCGATAAAGTCTC
GGTTAAGAGATAGACTAAGGGGTCGTCGTCTTCTTTGTCGTGGTGATGACACATCTCTCTTTGTTAAGGTTTACATGGAA
GGCGTCCCCATTGGGAGAAAACTCGACCTTTGCGCATTCTCAGGCTACGAGAGTCTCTTAGAAAATCTTTCTCACATGTT
CGATACTTCCATCATCTGCGGTAAACGAGATAGAAAACATCATGTTTTGACATATGAAGATAAAGATGGAGACTGGATGA
TGGTCGGAGATATTCCATGGGATATGTTTCTTGAAAACGTGAGAAGACTAAAGATCACGAGACCCGAGAGGTATTAA