Details for Capsella Locus Carubv10016086m

Position : scaf_3 ( 5`- 7474183 .. 7475409 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016086m

Protein [Map View]
METSPSSPPSSSPPEILHLDSIKALKILGKGATGTVFLALHDVVSTSSSSPFAVKLVHKSSASSLRRAQWEIEVLRRLSV
YSNQNPFLPRLLASFESPEYFAWAVPYCSGGDLNVLLRRQNDGVFSSSVIRFYVAEIVCALEHLHTMGIAYRDLKPENIL
IQHSGHVTLTDFDLSRSLKKPTRPHFYQPDPELCIDRKKSRSFSRLTATESKNKTGLKKTRSARVNPINRRKTSFSSGER
SNSFVGTDEYVSPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGKSKKETFRNVLMKEPEFAGKPNDLTDLIRRLLVK
DPERRLGCHRGVAEIKEHAFFAGVRWDLLTEVLRPPFIPLRDDGELTVGGFDIREHFEKLRTTSSSAPPSPLRSPPHVCR
KNDPFIDF*

DNA
ATGGAGACATCGCCATCGTCCCCACCATCATCATCACCGCCGGAGATCCTCCACCTTGACTCTATCAAAGCTCTCAAGAT
CCTTGGTAAAGGTGCAACAGGAACCGTCTTCCTCGCTCTCCACGACGTCGTTTCTACCTCTTCTTCTTCTCCCTTCGCCG
TGAAGCTCGTTCACAAGTCCTCTGCCTCATCTCTCCGACGTGCACAGTGGGAAATCGAGGTTCTCCGTCGTCTCTCCGTT
TATTCTAACCAAAACCCTTTTCTCCCTCGTCTCTTAGCTTCTTTCGAGTCGCCGGAATATTTTGCTTGGGCCGTCCCTTA
TTGCTCCGGCGGCGATCTTAATGTGCTCCTTCGCCGTCAAAACGACGGCGTTTTCAGCTCCTCTGTTATTAGATTCTACG
TGGCTGAGATCGTCTGTGCGCTTGAGCATCTTCATACCATGGGGATCGCTTACAGAGACTTGAAACCTGAGAACATTCTC
ATTCAGCACTCCGGTCACGTCACCTTAACCGATTTTGACCTTTCCCGAAGCCTCAAAAAGCCCACCCGCCCCCATTTCTA
TCAACCCGACCCGGAATTATGCATCGATCGTAAAAAAAGTCGGAGCTTTTCTCGGTTGACGGCGACAGAGAGCAAAAACA
AAACAGGGTTGAAGAAAACGAGATCCGCTCGGGTTAACCCGATTAATCGCCGGAAAACGAGTTTCTCCTCCGGCGAACGT
TCCAATTCCTTTGTCGGAACCGACGAGTACGTCTCGCCGGAGGTAATTCGCGGCGACGGTCATGACTTCGCCGTGGACTG
GTGGGCTCTCGGCGTTTTAACATACGAAATGATGTACGGTGAGACACCTTTCAAAGGGAAGAGCAAGAAGGAGACTTTTC
GTAACGTGTTGATGAAGGAACCAGAGTTCGCGGGAAAACCCAACGACCTCACTGATCTGATACGGCGGTTGCTTGTGAAG
GATCCGGAGCGCCGGTTAGGTTGCCACCGTGGCGTGGCGGAGATAAAAGAGCACGCTTTTTTCGCGGGTGTGAGGTGGGA
TTTATTAACGGAGGTGTTACGACCACCGTTTATTCCGTTAAGAGATGACGGAGAATTAACGGTAGGTGGGTTCGACATAA
GGGAACATTTTGAGAAGCTGAGGACGACGTCGTCATCAGCTCCTCCGTCACCGTTACGGTCTCCGCCTCACGTGTGTCGT
AAAAATGATCCGTTCATTGATTTCTGA