Details for Capsella Locus Carubv10016083m

Position : scaf_3 ( 5`- 13426203 .. 13429843 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016083m

Protein [Map View]
MAGFIRRKGNVFPRSQTLAAVYSKLQRSYCILAEGVMEKCSTILQVIDEDINSVDTSKWKKVRASDAGIRNSMIPDSSMN
VLRLLRRQGFDAYLVGGCVRDLILHRVPKDYDVITTANLKQIRRLFHRAQVIGKRFPICHVWMGGSIIEVSSFDTVAHSD
SGSENDLDKSKEKYDVPLDIEADKNNSLFKLYSGCDVRDCNRWRNSLQRDFTINSLFYDPFDFKIYDYTNGMEDLTDLKL
RTLVPAHLSFKEDCARILRGLRIAARLGLSLSKDVETAIPEFVSSVANLGQFRLIMEMNYMLAYGAAAPSILLLMKFKLL
HVLLPFQAAYLDQASETSLSTSLMLVRLFSNMDKLVSCDQPADSKLWIAVLAFHIALVRNPQEAIVVRAFAALLYHRNWR
KAVEFARGHETSVVGYTPEVLKSLRKRSDEDLAEAVSEFICILKDTQYVLTDIEALREALYLYPDFKFSGLVFIPKKKGR
DVAEGFARLSDVEYYESEKEGFSIDYLSLGKGNSCEVRFVLGKIILDTITEGIVIEPLNSVKKKQNTSKQNVPATCLENK
DELVVSKSSKEDNNNQAPVHGSNASSVLKILKKMRKDNENKNDQETDVCPRTLSGPAENQDKSIVQKLKRRRSKEALVSE
PPKQKTAKRLRSDDQEAVGSLSIPANNEHQSNKHCTNAPISEPPMQKTSKNRSKEMQKVKHNDLPVKELQEANSSFVSDK
SMSDLLKVLEKSSQQASGKEDSDGLGSSSEKTKRPKNLSSLFM*

DNA
ATGGCGGGTTTCATTAGGCGCAAAGGAAACGTATTTCCTCGGTCTCAGACCTTAGCTGCAGTCTACTCCAAGTTGCAGAG
AAGCTATTGCATACTTGCTGAGGGAGTCATGGAGAAGTGTTCTACCATTCTTCAAGTTATTGACGAAGATATAAATTCAG
TTGATACATCAAAGTGGAAGAAGGTACGAGCAAGTGATGCTGGAATTAGAAATTCAATGATCCCAGATTCCTCTATGAAT
GTGTTGAGACTTCTTAGACGTCAAGGTTTTGATGCATACCTTGTGGGTGGATGTGTAAGGGATTTGATACTACATAGAGT
ACCAAAAGACTATGATGTGATCACTACAGCTAATCTTAAACAGATCCGGCGGTTATTTCATCGTGCTCAGGTTATTGGGA
AACGCTTTCCTATTTGTCATGTGTGGATGGGAGGTTCGATAATTGAGGTGTCCAGTTTTGATACCGTGGCTCACAGTGAC
AGTGGGAGTGAAAATGATTTGGATAAGTCCAAAGAGAAATATGATGTTCCACTAGATATCGAGGCAGACAAGAATAACAG
CCTCTTCAAATTGTATTCTGGTTGTGATGTAAGAGACTGTAATCGTTGGAGGAATAGCTTGCAGCGTGATTTCACAATTA
ACAGTTTATTCTATGATCCCTTTGACTTTAAAATTTATGACTACACCAACGGAATGGAAGACTTGACGGATCTTAAGCTT
CGTACACTTGTCCCTGCACATTTGTCATTCAAGGAAGATTGTGCTAGAATTCTTAGGGGGTTAAGAATTGCAGCACGATT
GGGTCTATCATTGTCAAAGGATGTTGAGACTGCAATACCTGAGTTTGTATCTTCCGTTGCAAATTTGGGCCAGTTTAGAT
TAATCATGGAAATGAATTATATGCTTGCGTATGGAGCTGCTGCGCCTTCCATCCTTCTTCTCATGAAGTTCAAACTACTT
CATGTGTTACTTCCTTTTCAGGCAGCTTACCTGGATCAAGCTAGTGAAACATCTCTATCAACTTCCTTGATGCTAGTGAG
GTTATTCTCCAATATGGATAAATTGGTTTCCTGCGATCAACCAGCTGACTCCAAACTATGGATTGCAGTGTTAGCTTTTC
ACATTGCACTAGTACGTAACCCCCAGGAGGCTATTGTAGTGCGCGCTTTCGCTGCTTTGCTCTACCATCGAAACTGGAGG
AAAGCTGTTGAGTTTGCTAGAGGACATGAAACTTCAGTAGTCGGATACACTCCTGAGGTATTAAAATCTTTGAGAAAGAG
ATCTGATGAAGATCTTGCTGAAGCAGTTTCAGAATTCATATGTATATTAAAAGATACTCAATACGTTCTGACTGATATAG
AGGCTCTCCGCGAAGCCCTATACCTATACCCGGATTTCAAATTCTCTGGACTGGTATTTATACCGAAGAAAAAGGGGAGA
GATGTAGCAGAAGGGTTTGCGAGATTGAGTGATGTTGAATATTACGAAAGCGAAAAGGAGGGATTCTCTATTGACTATCT
CTCACTTGGGAAGGGAAATTCATGTGAAGTAAGATTTGTTCTTGGCAAAATCATTCTGGACACCATCACAGAAGGTATCG
TCATTGAACCTCTAAACTCAGTCAAGAAGAAGCAGAACACCAGTAAGCAAAATGTTCCAGCGACTTGCTTGGAGAATAAG
GATGAGTTGGTTGTTTCTAAATCGTCAAAGGAGGATAACAACAATCAAGCTCCAGTCCATGGCTCAAATGCATCATCAGT
TTTAAAGATTTTGAAGAAGATGAGAAAAGACAATGAGAACAAGAATGACCAAGAGACCGATGTATGTCCAAGAACCCTCT
CTGGTCCAGCAGAGAATCAAGATAAATCTATAGTTCAAAAGCTGAAAAGACGGCGTAGCAAAGAAGCACTAGTCTCTGAG
CCGCCTAAGCAAAAGACTGCAAAGAGGTTGAGATCAGATGACCAAGAGGCGGTTGGAAGTCTCTCTATACCTGCAAATAA
TGAGCATCAGAGTAATAAGCATTGCACAAATGCACCGATCAGTGAGCCACCTATGCAAAAGACTTCAAAGAACCGTTCAA
AGGAGATGCAAAAAGTGAAGCACAACGATTTGCCTGTGAAGGAGCTTCAAGAAGCAAACAGCAGCTTCGTTTCTGACAAA
TCTATGAGCGATCTTCTGAAAGTTCTTGAGAAATCAAGTCAGCAAGCGTCTGGCAAAGAGGATAGCGACGGCTTAGGCTC
TTCATCAGAGAAGACGAAGAGACCAAAAAACCTCTCAAGCCTTTTCATGTGA