Details for Capsella Locus Carubv10016082m

Position : scaf_3 ( 5`- 4728163 .. 4729278 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016082m

Protein [Map View]
METWEKPIPSSHHRRHPSFSSSLLDQIYRSIDDSSPASLDSTRNKKHHHHHHHRHEVSPADHRRSVAADFERSMRRSTTA
TDFLIHSNSSSSDSSGGAFSSSESDSFYGRSKSSASPPPPSSTRQQPKPIRTSTVDHSSPLQKPKELGGFLRTKSKALKI
YSDLKKVKQPISPGGRLATFLNSLFTNAAAANPKKQRKKTTSPVRVGETVHSSSTTCSSASSFSRSCLSKTPSSSGKSKR
SVRFCPVNVILDEDSSTIPMPYTYNNRLYGSNEDKRDVMEEHRRVIQAAKDLLRTYHNKNKVTTTYDEDIKYIANVEEDE
DDDAASCASSDLFELENLSAIGIERYREELPVYETTRLDNMNRAIATGLTV*

DNA
ATGGAGACTTGGGAGAAGCCTATCCCTTCATCTCACCACCGTCGTCACCCTTCCTTCTCCTCCTCTCTCCTCGACCAAAT
CTACCGCTCCATCGACGATTCCTCCCCTGCCTCCCTCGACTCCACTAGAAACAAGAAACATCATCATCATCACCATCACC
GTCATGAGGTCTCTCCAGCTGATCACCGCCGCTCTGTCGCCGCTGATTTCGAGAGATCCATGAGGAGGAGTACTACCGCC
ACCGACTTTCTCATACATTCTAACTCCAGCTCCTCTGATTCTAGCGGCGGTGCATTCTCATCTTCCGAGTCTGATTCTTT
CTACGGTCGCTCCAAATCTTCTGCCTCCCCTCCTCCTCCGTCCAGTACTCGTCAACAACCCAAGCCTATCCGAACATCGA
CCGTCGACCACTCCTCCCCCCTCCAGAAACCTAAAGAACTCGGTGGCTTCTTGAGAACCAAGTCAAAAGCGTTAAAGATC
TACTCCGATTTGAAAAAAGTGAAACAACCCATCTCCCCCGGCGGCAGACTCGCTACTTTCCTTAACTCTCTTTTCACCAA
CGCCGCCGCAGCTAACCCTAAGAAGCAGCGCAAGAAAACCACCTCCCCCGTGCGCGTGGGAGAAACAGTACACTCCTCCT
CCACCACATGCTCCTCCGCCTCGTCCTTCTCCAGGTCTTGCTTGAGTAAAACCCCGTCGTCTAGCGGCAAATCAAAAAGA
TCCGTACGGTTCTGTCCAGTCAATGTGATCCTCGACGAAGATTCCTCTACCATTCCCATGCCATACACTTACAACAACAG
GCTCTACGGTAGTAACGAAGATAAACGCGACGTTATGGAAGAGCATCGCCGTGTCATCCAAGCTGCCAAGGATCTTCTCA
GAACTTACCATAACAAAAACAAGGTTACTACAACGTACGACGAGGACATCAAGTACATCGCCAATGTAGAAGAAGACGAG
GACGATGATGCCGCGAGTTGCGCGAGCTCTGATCTATTCGAATTGGAGAATCTCTCGGCGATTGGGATCGAGAGGTATCG
AGAAGAGCTCCCAGTTTACGAAACCACTCGTCTTGATAATATGAATCGAGCCATTGCTACTGGCTTAACTGTATAA