Details for Capsella Locus Carubv10016081m

Position : scaf_3 ( 5`- 915971 .. 918383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016081m

Protein [Map View]
MDQEQSPHSPTGHSRSPPSSASGSTSAEPVRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGAVGDANVFY
WFQNRRSRSRRRQRQLQAAAAAAAATTNTCDQTMMVSNGLAHHSGSDLGFGGCSTSSNYLFGGSSQVPSFYLGLSSSPPS
CSSSYSTSSSASSSSSSYGGGGGCDNQSSSGMENLLTMSGQMGYHEANHHHYQHQSSNVASILCPPDQNSSFHYQQGGII
TVFINGVPTEVTRGGIDMKATFGDDLVLVHSSGVPLPTDEFGFLMHTLQHGESYFLVPR*

DNA
ATGGACCAAGAACAATCCCCACATAGCCCAACCGGCCATAGTCGCTCACCACCATCATCCGCCTCCGGTTCCACCTCAGC
AGAGCCGGTTCGATCACGATGGTCACCTAAACCGGAACAAATACTCATTCTTGAATCGATCTTCAACAGTGGGATGGTTA
ACCCTCCAAAAGAAGAGACGGTAAGGATTCGAAAGATGCTCGAGAAATTTGGCGCTGTGGGAGATGCAAATGTCTTCTAT
TGGTTTCAAAACCGGCGTTCAAGATCCCGCCGGAGGCAGAGACAGCTCCAGGCCGCAGCTGCAGCAGCGGCCGCAACCAC
CAACACTTGTGACCAGACCATGATGGTGAGCAACGGCTTAGCACATCATAGTGGGAGTGATTTGGGGTTTGGAGGATGTA
GCACTTCTTCTAATTACTTATTTGGTGGGTCATCCCAAGTTCCTTCCTTTTACCTTGGTCTCTCTTCTTCTCCTCCTTCT
TGTTCAAGCTCCTATTCCACTTCTTCTTCAGCTAGCTCTTCCTCTTCTTCTTATGGTGGTGGTGGTGGATGTGATAATCA
AAGCAGTAGTGGCATGGAGAATCTCTTAACAATGTCTGGCCAAATGGGTTACCATGAAGCTAATCATCATCATTATCAAC
ATCAAAGCTCAAATGTCGCGTCGATTTTGTGTCCACCTGATCAAAACTCCAGTTTTCACTACCAACAAGGGGGGATTATA
ACGGTGTTTATAAACGGAGTTCCGACAGAAGTAACGAGAGGAGGAATAGACATGAAAGCAACGTTTGGAGATGATTTGGT
TTTGGTGCATTCCTCAGGTGTTCCTCTCCCAACTGATGAGTTCGGTTTTTTGATGCATACCTTACAACACGGTGAATCTT
ATTTCCTGGTTCCAAGATAG