Details for Capsella Locus Carubv10016080m

Position : scaf_3 ( 5`- 6192745 .. 6194827 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016080m

Protein [Map View]
MASMSFALNRFSGLASKTSLSADFDPSSRRSFLPPTRVGLRISAAAAAESEPDLSVTVNGLKMPNPFVIGSGPPGTNYTV
MKRAFDEGWGAVIAKTVSLDASKVINVTPRYARLRTGSNGSAKADVIGWQNIELISDRPLETMLKEFKQLKQEYPDRILI
ASIMEEYNKTAWEELIDRVEQTGVDALEINFSCPHGMPERRMGAAVGQDCALLDEVCGWINAKATVPVWAKMTPNITDIT
EPARVSLKSGCEGIAAINTIMSVMGVDLKTLRPEPCVEGYSTPGGYSYKAVRPIALAKVMSIAKMMKSEFSGNDYSLSGI
GGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELQDFMKQHNFSTIEDFRGHSLQYFTTHTDLVKRQKEAVEQ
RKAEKRGLKSDKDWTGDGFVKETESMVSN*

DNA
ATGGCTTCCATGAGTTTCGCCTTGAACCGCTTCTCTGGTCTCGCCTCTAAAACCAGCTTATCAGCTGACTTCGATCCTTC
CTCTCGCCGGAGTTTTCTACCGCCAACTAGAGTTGGTCTTAGGATCTCTGCTGCTGCCGCCGCCGAATCTGAGCCTGATC
TCAGTGTCACTGTAAATGGCTTGAAAATGCCAAATCCTTTCGTAATCGGGTCTGGTCCACCCGGTACCAACTACACCGTC
ATGAAGAGAGCCTTTGATGAAGGTTGGGGAGCCGTCATCGCCAAAACCGTATCACTAGATGCATCCAAAGTTATCAACGT
CACACCTCGATATGCCCGGCTACGAACCGGATCAAATGGCTCAGCCAAAGCAGATGTAATTGGGTGGCAGAACATAGAAC
TCATTAGTGACCGACCTCTCGAAACCATGCTCAAAGAGTTTAAGCAATTGAAACAAGAGTACCCTGATCGGATCCTTATA
GCTTCCATCATGGAGGAATACAACAAAACTGCTTGGGAAGAGCTCATCGACCGTGTTGAGCAAACTGGTGTTGATGCTTT
AGAGATCAACTTCTCGTGTCCTCATGGTATGCCAGAGCGCAGAATGGGTGCTGCTGTTGGACAAGATTGTGCGCTTCTGG
ACGAGGTTTGCGGATGGATTAACGCTAAAGCTACAGTTCCTGTATGGGCTAAGATGACTCCTAATATCACTGACATAACA
GAGCCTGCTAGGGTATCATTAAAATCAGGATGTGAAGGCATTGCAGCTATCAATACAATCATGAGTGTAATGGGAGTTGA
TTTGAAGACGCTGCGTCCTGAGCCATGTGTTGAAGGTTACTCGACTCCAGGAGGCTACTCTTATAAGGCTGTTCGTCCCA
TCGCGCTTGCGAAAGTTATGAGCATTGCCAAAATGATGAAATCTGAGTTCAGTGGGAATGATTACTCGCTTTCGGGTATT
GGAGGTGTTGAAACTGGCTATGATGCCGCTGAATTCATTCTCCTCGGATCAAATACTGTACAGGTATGCACCGGTGTGAT
GATGCACGGTTATGGTCATGTGAAAACCCTTTGCGCCGAGCTTCAAGATTTCATGAAACAGCACAATTTCTCGACAATAG
AAGACTTCAGAGGGCATTCGCTGCAGTACTTTACAACACACACAGATTTAGTTAAGAGACAGAAAGAAGCGGTTGAGCAG
AGAAAAGCAGAGAAGAGAGGCTTGAAATCTGACAAAGATTGGACCGGAGATGGGTTCGTGAAGGAGACTGAGAGTATGGT
TTCTAACTAA