Details for Capsella Locus Carubv10016079m

Position : scaf_3 ( 5`- 6462465 .. 6463168 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016079m

Protein [Map View]
MTRDDNQWTSGLCQCAEDGETVCLTCFCPCVTFGRIADIADEGRSGCPRCGILYGLLCFFVGLPCLFSCTYRTKIRNRFG
LPESPASDCLTHCCCECCALCQEYRELKNRGVDPSIGWNGNVQRRMAPPMNQQMMG*

DNA
ATGACAAGGGATGATAACCAATGGACTTCTGGTCTTTGCCAGTGCGCAGAGGACGGTGAAACTGTTTGCCTCACATGTTT
CTGCCCGTGCGTCACTTTTGGACGGATCGCGGATATTGCCGACGAAGGAAGGAGCGGTTGTCCAAGATGTGGGATACTTT
ACGGACTGCTATGTTTTTTTGTCGGCTTACCTTGCTTGTTCTCATGCACTTACCGAACCAAGATCCGAAACAGATTCGGG
TTACCGGAGTCTCCAGCTTCGGATTGCCTCACTCACTGCTGTTGTGAATGTTGTGCTCTTTGCCAAGAATACCGTGAACT
CAAAAACCGTGGTGTTGACCCATCTATCGGGTGGAATGGGAATGTGCAACGGAGGATGGCTCCTCCCATGAATCAGCAGA
TGATGGGTTGA