Details for Capsella Locus Carubv10016078m

Position : scaf_3 ( 5`- 7348820 .. 7353805 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016078m

Protein [Map View]
MGVSLRHLSPSSFWVTRRPRVSSSILSFLVPRRRIICRKIAITNGNSGYSTATDCGGSHGFQLSGHQRSSSVEFCGEWKL
NLGSKTARMVPPTVKQAGTVSAWREEANKFRGRNEEHANNQDDAFSKGSYSFKGFVPKIDDVQSYGNGQNFDYKLKPGSD
ITTLDRELNGFMPTNSIRGPVIALPSKDIEVEGKTDVTLKGDKDAHGKQKPLQSELSLDNASYKKSATISKVEKGTDLSK
VRANLKKIYKRVLVIDDVYTAKETVAKLMNEYRNLVHACDTEVSRIDVKTETPVDHGEMICFSLYCGSEADFGDGKSCIW
VDVLGENGRDILAEFKPFFEDSSIKKVWHNYSFDNHIIRNYGIKLSGFHGDTMHMARLWDSSRRASGGYSLEALTSDPRV
LGGTETKEEAELFGKISMKKIFGKGKLKKDGSEGKLVIVPPVEELQKEDREAWISYSALDSISTLKLYESMKKQLQVKQW
FLDGNLISKKNMFDFYHEYWQPFAELLAKMEAEGMLVDRDYLAQIEIVAKAEQEIAVSRFRNWASKHCPDAKHMNVGSDT
QLRQLFFGGISNSCNEEDLPYEKLFKVPNVDKVIEEGKKKATKFRNIKLHRISDHPLPTEKFTASGWPSVSGDTLKALAG
KVSAEYDYMDGISDTFLEENSGDDDFVSLPDEILETQHSDTSVESDTSAYGTAFDAFGGGETGKEACHAIAALCEVCSID
SLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALEKDRYKIRQAFIASPGNSLIVADYGQLELRIL
AHLTRCKSMMEAFIAGGDFHSRTAMNMYPHIREAVENGEVLLEWHPQPGQEKPPVPLLKDAFASERRKAKMLNFSIAYGK
TAVGLSRDWKVSREEAQDTVDLWYNDRQEVRKWQELRKKEAIQKGYVLTLLGRARKFPVYSSRAQKNHIQRAAINTPVQG
SAADVAMCAMLEISKNQRLKELGWKLLLQVHDEVILEGPSESAETAKDIVVNCMCKPFNGKNILSVDLSVDAKCAQNWYA
GK*

DNA
ATGGGGGTTTCTCTTCGTCACCTCTCTCCTTCCTCTTTCTGGGTTACGCGTCGTCCTCGTGTTTCTTCTTCAATTCTTTC
TTTTCTTGTGCCTCGCCGTAGAATCATTTGCAGGAAAATAGCTATCACCAATGGAAATTCCGGATATTCCACTGCTACTG
ATTGTGGGGGTTCCCATGGATTTCAGCTTTCGGGTCATCAACGGTCGTCCTCTGTTGAGTTTTGTGGAGAGTGGAAACTT
AATTTGGGATCTAAGACGGCAAGAATGGTTCCGCCAACTGTGAAACAAGCTGGAACTGTAAGTGCTTGGAGGGAGGAAGC
CAATAAGTTCAGAGGAAGAAATGAGGAACATGCTAACAACCAGGATGATGCTTTTAGTAAAGGCAGTTATTCTTTCAAAG
GCTTTGTCCCCAAAATAGATGATGTCCAATCTTATGGAAACGGCCAGAACTTTGATTACAAGCTGAAGCCAGGAAGTGAT
ATTACCACGCTTGATAGAGAATTGAATGGCTTTATGCCAACTAATAGTATAAGAGGACCAGTCATAGCATTACCAAGCAA
GGATATTGAGGTTGAGGGAAAAACAGACGTGACTCTGAAAGGAGATAAGGATGCACATGGAAAACAAAAACCTCTTCAGA
GTGAGTTGTCTCTTGACAATGCAAGCTATAAGAAGTCAGCAACCATTTCCAAGGTGGAAAAAGGCACCGACCTTTCGAAA
GTCCGGGCAAACCTGAAGAAAATATATAAGAGGGTTCTTGTTATCGATGATGTTTACACTGCAAAGGAAACTGTGGCTAA
GCTCATGAATGAATATAGAAATCTTGTCCATGCTTGCGATACAGAGGTTTCCAGGATTGATGTGAAGACTGAAACACCTG
TAGACCATGGGGAGATGATATGTTTCAGTTTATATTGTGGATCAGAAGCAGATTTTGGAGATGGAAAATCATGTATCTGG
GTAGATGTCCTTGGCGAAAATGGAAGGGATATCTTGGCTGAGTTTAAGCCATTTTTCGAAGACTCATCAATAAAAAAAGT
ATGGCATAACTACAGTTTTGATAACCACATTATCAGAAATTATGGAATCAAGCTTTCTGGTTTTCATGGTGATACAATGC
ACATGGCACGATTGTGGGATTCATCTAGACGGGCATCTGGTGGTTATTCGCTCGAAGCACTTACAAGTGACCCAAGAGTT
CTTGGGGGAACTGAGACAAAGGAGGAAGCAGAATTATTTGGTAAAATATCTATGAAAAAGATTTTTGGAAAGGGAAAACT
GAAAAAAGATGGATCAGAGGGGAAATTGGTTATTGTTCCTCCTGTTGAAGAGCTACAAAAGGAGGATCGAGAAGCTTGGA
TTTCCTACTCGGCGTTGGATTCGATAAGCACACTTAAGCTCTATGAGAGCATGAAGAAACAACTGCAAGTGAAGCAATGG
TTTCTTGATGGAAATCTAATTTCAAAAAAGAACATGTTTGATTTCTACCATGAATATTGGCAACCTTTTGCTGAACTTCT
TGCCAAAATGGAAGCGGAAGGAATGCTTGTAGATAGGGATTATTTGGCGCAGATTGAGATTGTAGCCAAAGCAGAACAAG
AAATTGCTGTTTCAAGGTTCCGGAATTGGGCTTCAAAACATTGTCCAGATGCGAAGCATATGAATGTTGGCAGTGACACG
CAATTGCGTCAACTCTTTTTTGGTGGCATTTCTAACAGTTGTAATGAAGAGGATCTTCCATATGAAAAACTATTCAAAGT
TCCCAATGTTGATAAGGTGATTGAAGAAGGAAAAAAGAAAGCCACAAAATTCCGGAATATCAAACTGCATAGGATTAGCG
ACCATCCTTTACCCACTGAAAAGTTCACTGCCTCAGGCTGGCCCTCTGTTAGTGGAGACACCTTGAAAGCCTTAGCTGGG
AAAGTCTCTGCAGAATATGACTATATGGATGGCATTTCAGATACTTTTCTAGAAGAAAACTCTGGAGATGATGATTTTGT
TTCGCTACCAGATGAAATTTTAGAAACACAACACTCAGATACCTCTGTTGAATCAGACACATCTGCTTATGGAACAGCAT
TTGATGCGTTTGGAGGGGGTGAAACAGGAAAGGAGGCTTGCCATGCTATTGCCGCACTATGTGAAGTTTGCTCCATTGAT
TCCTTAATTTCAAATTTTATTCTTCCGTTGCAGGGAAGTAATGTGTCCGGAAAAGATGGTCGTGTCCACTGCTCCCTGAA
TATTAACACTGAAACTGGCCGCTTATCGGCTAGAAGGCCAAATTTGCAGAACCAACCTGCATTGGAGAAAGATCGGTACA
AGATCCGTCAGGCCTTCATAGCATCACCTGGAAATTCACTTATTGTTGCCGATTATGGACAGCTGGAACTTAGGATTTTG
GCACATCTTACTCGTTGCAAAAGTATGATGGAAGCTTTCATAGCTGGTGGAGACTTCCACTCAAGAACAGCCATGAATAT
GTATCCACATATTCGTGAAGCTGTTGAAAATGGTGAAGTGCTCCTTGAATGGCATCCACAACCTGGACAAGAGAAGCCAC
CAGTGCCATTATTGAAGGATGCCTTCGCTTCTGAGAGAAGAAAAGCAAAGATGCTTAACTTCTCGATTGCGTATGGTAAG
ACTGCTGTTGGCCTCTCTAGAGATTGGAAGGTTTCAAGAGAAGAAGCTCAAGATACAGTTGATCTCTGGTATAATGACAG
ACAAGAAGTCCGCAAATGGCAAGAACTACGCAAGAAAGAAGCTATACAAAAGGGGTATGTACTCACTTTGTTGGGAAGGG
CTCGTAAATTTCCTGTATACAGTTCACGTGCCCAAAAGAACCATATCCAACGAGCAGCAATCAACACTCCTGTTCAGGGA
AGCGCCGCTGATGTTGCTATGTGCGCTATGCTCGAGATATCAAAAAACCAACGTCTAAAAGAGCTTGGCTGGAAATTGCT
TCTACAAGTTCATGATGAAGTAATTTTGGAAGGACCTAGTGAGTCAGCGGAGACTGCTAAAGACATAGTTGTGAACTGCA
TGTGTAAACCGTTCAACGGCAAGAATATTCTCTCAGTCGACTTATCTGTTGATGCTAAGTGTGCTCAGAACTGGTATGCT
GGCAAATAA