Details for Capsella Locus Carubv10016073m

Position : scaf_3 ( 5`- 8479863 .. 8480480 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016073m

Protein [Map View]
MERSNNIELRNSFYGRARTSPWSYGDYDTYQQDHEYLLGFSWPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLRLQQ
SSSSSSTPSPPYPNPNYSYSSMATSPPPHHHSPLTLFPNLSPPSSPEYRADVVRSLSPKSEHTPENACETEKSSLLLEDV
EAKRLSNKDACKFLRNDEIISLELEIGLINESEQDLDLELRLGFA*

DNA
ATGGAGAGATCAAACAACATAGAGTTGAGGAACAGCTTCTACGGCCGTGCAAGAACTTCACCATGGAGCTATGGTGATTA
TGATACTTACCAACAAGACCATGAGTATCTTCTAGGGTTTTCATGGCCACCAAGGTCCTACACTTGCAGCTTCTGCAAAA
GGGAATTCAGATCGGCTCAAGCACTTGGTGGCCACATGAATGTTCACAGAAGAGACAGAGCCAGACTCAGATTACAACAG
TCTTCATCATCATCTTCAACACCTTCTCCTCCTTACCCTAACCCTAATTACTCGTACTCTTCCATGGCAACCTCTCCTCC
TCCTCATCATCATTCTCCTCTAACCCTATTTCCAAACCTTTCTCCCCCGTCCTCGCCAGAATATAGGGCAGATGTGGTCC
GTTCCTTGAGCCCCAAGTCAGAACATACACCAGAAAACGCTTGTGAGACTGAGAAATCATCTCTTTTATTGGAGGATGTA
GAAGCTAAAAGGTTGAGCAATAAAGATGCTTGTAAGTTCTTGAGGAACGATGAAATCATCAGCTTGGAGCTTGAGATTGG
TCTGATCAACGAATCAGAGCAAGATCTGGATCTAGAACTCCGTTTGGGTTTCGCTTAG