Details for Capsella Locus Carubv10016071m

Position : scaf_3 ( 5`- 4449256 .. 4449709 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016071m

Protein [Map View]
MKVNFCLIASLLILTLVISSYVVLAQPHNSKEETIAEEMIHIRKIMKIGAPRSKSPPDRQWGERDSPPAAGPNTL*

DNA
ATGAAGGTCAATTTCTGTTTGATTGCTTCGCTTTTGATTCTCACTTTGGTGATTTCGTCATACGTCGTTTTAGCTCAACC
ACACAATTCCAAAGAAGAAACAATAGCAGAAGAAATGATTCACATTCGAAAGATAATGAAGATCGGAGCACCTCGTAGTA
AGTCACCACCCGATCGCCAATGGGGTGAGCGTGACTCGCCACCAGCCGCAGGTCCAAATACACTGTAA