Details for Capsella Locus Carubv10016068m

Position : scaf_3 ( 5`- 6455864 .. 6456835 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016068m

Protein [Map View]
MFSSLSAPSSLSSSLISSFVADKAPPVTGSLIPRRDLISVRVKASSSQNGSDYCFPEKLKSFAKSAILIGAAVSMTGKFA
TLPVKAESPVTTTEETFEEVKDEKLSEIETSSPLSELLDSTPEAVETLRSLLQQKLEKGEDEEALKLLERLVTAQPEETE
WKFLMARLLGEMGRVENARQMFEEILRQKPLSFEALFENALLMDRSGEGNAVLQRLEDALAVAEAEYLVKEARDVRLIIA
QIHFLQKNVDEALKSYEQLTREDPKDFRPYFCRGMIYSLLDKNVEAKEQFAKYRELSPKKFEVEGYLRTPLSKMKLFGGG
DDN*

DNA
ATGTTTTCGTCTCTCTCAGCTCCTTCCTCACTCTCTTCTTCGTTGATTTCTTCGTTCGTCGCCGACAAAGCACCTCCGGT
CACCGGATCTCTGATTCCTCGTCGCGATCTTATTTCTGTTCGTGTCAAAGCTAGCTCAAGTCAGAATGGTTCCGATTATT
GTTTTCCGGAAAAGCTCAAATCTTTTGCTAAATCAGCAATTCTCATTGGCGCTGCTGTTTCCATGACCGGAAAGTTCGCA
ACTTTACCGGTGAAAGCGGAGTCTCCGGTTACGACGACCGAAGAAACCTTCGAGGAAGTGAAAGACGAGAAATTGTCTGA
GATCGAAACTTCTTCGCCATTGTCTGAGCTTCTAGACTCTACTCCTGAAGCCGTCGAAACGCTCAGATCACTCCTGCAGC
AGAAGCTAGAGAAAGGAGAAGATGAGGAAGCTCTCAAGCTACTAGAGAGGCTCGTAACGGCACAACCAGAGGAAACAGAG
TGGAAGTTTTTGATGGCGAGGCTATTAGGAGAAATGGGTCGCGTGGAAAACGCACGCCAAATGTTCGAGGAAATTCTCCG
ACAAAAGCCACTCTCGTTCGAGGCTTTATTCGAGAACGCATTGCTCATGGACAGGTCCGGGGAAGGAAATGCAGTGCTGC
AGAGGCTGGAAGATGCGTTAGCTGTTGCCGAGGCTGAGTATTTGGTGAAGGAAGCGAGAGACGTGAGACTGATCATTGCA
CAGATACATTTCTTGCAGAAGAACGTGGATGAAGCATTGAAGAGCTACGAGCAGCTAACAAGAGAGGATCCGAAGGATTT
CAGACCTTATTTTTGTCGAGGTATGATCTATAGCTTGCTTGACAAGAACGTCGAAGCCAAGGAACAGTTTGCTAAGTACA
GAGAGCTTTCTCCAAAGAAGTTTGAAGTAGAAGGGTACTTGAGAACTCCATTATCTAAAATGAAGCTTTTTGGTGGTGGT
GATGACAACTGA