Details for Capsella Locus Carubv10016065m

Position : scaf_3 ( 5`- 1875715 .. 1875951 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016065m

Protein [Map View]
MKKKKFLKVVFLLVAYLTSIAMAGYHGCNKVAEKATRMSVVGEDSRDEFGNEEEEKKNVNLWSGRKLVSGPTRRGCGH*

DNA
ATGAAGAAGAAGAAGTTTCTTAAAGTTGTGTTCCTCTTGGTCGCTTACTTAACTTCCATTGCCATGGCTGGTTACCACGG
CTGTAACAAGGTTGCAGAGAAAGCAACGAGAATGAGTGTCGTCGGAGAAGATTCAAGAGATGAGTTCGGGAACGAGGAGG
AGGAGAAGAAAAACGTGAATTTGTGGTCGGGTCGTAAGTTAGTTTCTGGTCCAACTCGTAGAGGTTGCGGTCACTAA