Details for Capsella Locus Carubv10016053m

Position : scaf_3 ( 5`- 8231083 .. 8231886 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016053m

Protein [Map View]
MSKILVVVVALIAVLALPIHGQQQPLSQCTPSMMTTVSPCMSFITNSSSNGTSPTSDCCNALRSLTTGGMGCLCLIVTGT
VPFNIPINRTTAVSLPRACNMPRVPLQCQANIAPAAAPGPAATFGPSMSPGPATNPIVPEPTPAAQTPQSDTTRPFTPSV
DGGAPTSDDGGSSSRPSETPSSAYALSPSLLFFSIALVALKFY*

DNA
ATGTCGAAGATTCTTGTCGTGGTGGTTGCGCTGATCGCCGTGCTAGCTTTGCCGATCCATGGTCAACAACAGCCGCTTAG
CCAATGTACTCCGTCGATGATGACCACCGTGAGTCCTTGTATGAGCTTCATAACAAACAGTAGCAGTAACGGAACTTCGC
CGACGTCTGATTGTTGTAACGCGCTGAGGTCTTTGACCACCGGAGGAATGGGATGTCTCTGTCTTATTGTCACTGGAACT
GTTCCTTTCAATATTCCGATTAACCGCACAACCGCTGTCTCTCTTCCCCGTGCTTGTAACATGCCTAGAGTGCCTCTTCA
ATGCCAAGCCAATATTGCTCCAGCTGCTGCTCCTGGACCTGCTGCTACATTTGGACCATCGATGTCTCCAGGTCCAGCGA
CGAATCCAATTGTTCCAGAGCCGACTCCAGCAGCTCAGACACCACAGTCTGACACAACCCGACCTTTTACACCATCTGTC
GACGGTGGAGCTCCGACTTCAGACGATGGAGGAAGCAGCAGTAGACCTTCTGAGACTCCTTCCTCCGCCTACGCACTCTC
ACCGTCTCTTCTCTTCTTCAGCATCGCCCTCGTAGCTCTCAAATTCTACTGA