Details for Capsella Locus Carubv10016043m

Position : scaf_3 ( 5`- 4774411 .. 4776342 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016043m

Protein [Map View]
MSALSFLYSSKNPRFRGVFNGICALVLFCFFFDRSDILRNPLLKDVSFVNGGSGSTSGGKFTQFTVIRRHVTEIETNGSG
NSSLSSSNTVLCSGLHRHMGYADQCEFLKANPSCSPDGFFDYLNFFYCSCRNFSILGYMILAVWLVALFYLLGNTAADYF
CCSLEKLSKLLRLPPTLAGVTLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADKEVKIDK
KCFIRDLSFFLFTLVSLLVILMVGKVTVRIAIAFVSIYVVYAFLVAANVILRKHAKRFKLEAITPLLPMQGSVFSPSVGE
DMPMHNPLIETETEEGPPRLQSLPQWMWASNVAIYSNHFAKVSLHDEDRPPWGWIDDSTEVESSSCNKFTSLLEIPLTIP
RRLTIPSVEEDTWSKTYAVASVSLAPILLASLWSSQDDVSAQGCGVAYFISVAIGSTLGFLAYKNTEPDHPPRRFLIPWV
LGGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALTMSGGDGVQIALSGCYAGPMFNTL
VGLGMSMLFGAWSKSPDTYMLPEDKSLFYTLGFLVLGLVWAMVILPRNDMRPNKTLGMGLISLYLIFVTFRLSCAMGFIP
WAA*

DNA
ATGAGCGCATTGAGTTTTCTTTACAGCTCGAAAAACCCCAGATTCCGAGGGGTTTTTAATGGGATTTGTGCTCTCGTTCT
GTTTTGCTTCTTCTTTGATCGGAGCGATATTCTCAGGAACCCTTTGTTGAAAGACGTTTCTTTCGTCAATGGCGGCAGTG
GTTCGACCTCCGGAGGTAAATTCACCCAGTTTACGGTAATTCGTAGGCATGTGACTGAAATTGAAACCAATGGTTCTGGC
AATAGCAGCTTGAGTAGCAGCAATACTGTTTTATGCTCCGGGTTACACAGACACATGGGATATGCTGATCAATGCGAGTT
CTTAAAAGCAAACCCAAGTTGTTCCCCTGATGGATTCTTTGATTACCTCAACTTTTTTTACTGCTCCTGCAGAAATTTCA
GCATCTTGGGTTACATGATCTTGGCTGTTTGGCTTGTTGCTTTGTTTTATCTCTTGGGCAATACTGCTGCCGATTACTTT
TGTTGTTCCTTGGAGAAGCTTTCTAAGCTTTTGAGGCTGCCTCCAACTCTTGCTGGTGTTACTTTGCTTCCACTTGGTAA
TGGAGCACCAGATGTGTTTGCAAGCATTGCTGCTTTTGTTGGAACAGATAAAGGAGAAGTTGGTCTTAACAGCGTCTTGG
GTGGTGCTGTGTTTGTTACCTCTGTTGTTGTTGGGATTGTTTCGCTCTGTGTTGCCGATAAGGAAGTCAAGATCGATAAG
AAATGCTTCATCAGAGACTTGAGTTTCTTCCTTTTCACGCTCGTGTCTTTGCTGGTGATTTTGATGGTTGGTAAAGTCAC
AGTAAGGATTGCCATTGCGTTTGTGTCTATATATGTGGTGTATGCTTTCCTTGTTGCAGCGAATGTGATTCTGAGAAAAC
ATGCTAAGAGGTTTAAACTAGAGGCTATTACTCCGTTGCTACCTATGCAAGGAAGCGTGTTTTCCCCGAGTGTTGGAGAG
GATATGCCAATGCATAACCCCTTGATTGAAACTGAAACTGAGGAAGGTCCACCTCGGCTACAGAGTCTTCCTCAGTGGAT
GTGGGCGTCAAATGTGGCCATCTATTCAAACCATTTCGCAAAAGTTAGTTTACATGATGAAGACAGGCCACCTTGGGGAT
GGATTGATGACAGTACAGAAGTTGAGAGCTCCTCATGTAATAAATTCACTTCCTTGTTAGAAATCCCGCTGACGATTCCA
AGGAGGTTAACAATTCCATCAGTCGAGGAAGATACATGGTCTAAGACATACGCTGTGGCCAGCGTCTCATTAGCGCCTAT
CCTTTTGGCGTCTCTCTGGAGTAGCCAAGACGATGTGAGTGCTCAAGGTTGTGGTGTGGCTTACTTTATAAGCGTTGCTA
TAGGCTCTACTCTTGGATTTCTTGCTTACAAAAACACAGAACCTGATCACCCACCTCGAAGATTCTTGATCCCTTGGGTT
CTTGGTGGGTTCATCATGAGCATCGTATGGTTCTACATGATTGCAAATGAACTTGTTGCTCTTCTGGTGACATTTGGTGA
AATATACGGAATTAACCCGTCAATACTTGCGTTAACAGTACTTGCTTGGGGAAACTCAATGGGTGACTTAGTGTCGAATA
TCGCACTGACTATGAGCGGTGGGGATGGTGTACAAATCGCTCTATCAGGATGCTATGCAGGTCCGATGTTCAACACACTG
GTCGGACTCGGTATGTCGATGCTTTTTGGCGCATGGTCCAAGAGTCCAGACACATACATGCTACCAGAAGACAAAAGCCT
GTTCTACACACTTGGGTTTTTAGTACTGGGTTTGGTTTGGGCAATGGTGATACTCCCGCGCAACGACATGCGACCTAACA
AAACCTTAGGTATGGGACTCATTTCACTATATCTGATATTCGTCACTTTTAGGCTCAGTTGCGCCATGGGATTCATACCA
TGGGCTGCTTAA