Details for Capsella Locus Carubv10016036m

Position : scaf_3 ( 5`- 8677460 .. 8681887 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016036m

Protein [Map View]
MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERPEGKPLPCVIYCHGNSGCRAD
GSEAAIVLLPSNITVFTLDFSGSGISGGEHVTLGWNEKDDLKAVVEFLRQDGNVSLIGLWGRSMGAVTSLMYGAEDPSIA
GMILDSPFSDLVDLMMELVDTYKFRLPKFTVKFAIQFMRRAIQKKAKFDIMDLNTIKVAKSSFVPVLFGHALDDDFIRPH
HSDRIYEAYIGDKNIIKFEGDHNSPRPQFYFDSVNIFFHNVLQPPEVVGPTFYDPLDDYFAKGSWGTMHDTNIPQSSVQK
SLAAGSIFEAINEVRKKRPMSRTDVPSNVTSNGSPSEAKEKESHDGHASSSPDMISFDLSNGDQYPPHLRMALDNDQYVE
YQMEDMGDFPSNAQEEERMLMKAVMESLKDLEVQSQQKEEAPETRIHGGSAFLKATQCLSSREESTSTRANQPETDSASS
PATCSQDQLPSSSESNPPSETSTSQARPIKASDPGSLSQKESETRDMSGVTKATVTVERSSSAPGKVLDGLIRRWDLNFF
KNSK*

DNA
ATGGAACAGCTTGTTAACTTCATCATTCGACCTCCAAGAGCTGAGTATGACCCGGAACATGATTTATTGGAAAAGGAGTT
CATGATGAAGGGTAGATGGTATCAGAGAAAGGATTTAGAGGTTAAAAATAGTAGGGGAGATGTTCTCCAGTGTAGTCATT
ATATGCCAGTTGAACGCCCTGAAGGAAAGCCTTTGCCCTGTGTGATATACTGCCATGGAAACAGTGGATGCAGAGCGGAT
GGCAGTGAAGCTGCAATTGTGTTGTTGCCTTCAAACATCACAGTTTTCACACTTGACTTTTCGGGATCAGGTATCTCAGG
CGGGGAACATGTCACCTTAGGCTGGAACGAAAAGGATGATCTGAAGGCTGTGGTTGAGTTTTTGCGGCAGGATGGAAACG
TATCTCTAATTGGGCTGTGGGGGCGGTCAATGGGTGCTGTTACTAGCTTGATGTATGGAGCCGAGGATCCTTCAATTGCA
GGAATGATTCTAGATAGCCCATTCTCTGATTTAGTGGATCTGATGATGGAACTTGTAGATACATATAAGTTTCGTCTGCC
GAAGTTTACTGTAAAGTTTGCAATACAGTTTATGCGGAGAGCTATTCAGAAAAAAGCAAAGTTCGATATAATGGATCTAA
ACACCATTAAGGTGGCAAAGTCGAGTTTTGTTCCAGTTTTATTTGGACATGCCTTAGATGATGACTTTATCCGCCCTCAT
CATTCAGATAGGATATATGAAGCCTATATAGGTGACAAAAATATCATCAAATTTGAGGGAGACCACAACTCCCCAAGGCC
CCAATTCTACTTTGATTCGGTAAATATATTTTTCCATAATGTTCTTCAACCTCCAGAGGTGGTGGGGCCGACATTTTATG
ACCCATTGGATGATTACTTTGCAAAGGGCAGTTGGGGCACTATGCATGACACAAATATTCCACAATCCTCGGTACAGAAA
AGTTTAGCCGCGGGTAGCATCTTTGAAGCTATTAATGAAGTACGCAAGAAACGACCCATGAGTCGCACAGATGTTCCTTC
GAATGTCACATCTAACGGTTCTCCATCAGAAGCTAAGGAAAAAGAGAGTCATGATGGACACGCCAGTTCATCTCCTGATA
TGATAAGCTTTGATTTGTCAAATGGCGATCAGTACCCTCCTCACCTTAGGATGGCTCTAGATAATGATCAGTATGTGGAG
TATCAGATGGAGGACATGGGAGATTTCCCATCTAATGCACAGGAAGAAGAAAGGATGCTTATGAAAGCGGTGATGGAATC
GTTGAAAGACTTGGAAGTGCAAAGTCAACAAAAAGAAGAAGCTCCTGAGACGAGAATTCATGGTGGCTCTGCATTTCTAA
AAGCAACTCAATGCCTTTCTTCCAGGGAAGAATCAACTTCAACTCGAGCAAATCAACCAGAGACTGATTCTGCTTCCAGT
CCAGCAACATGTAGCCAGGATCAACTACCGTCATCCTCCGAGTCCAATCCTCCAAGTGAGACCTCGACTTCTCAGGCAAG
ACCCATAAAGGCTTCTGATCCTGGCTCTTTAAGCCAGAAGGAAAGCGAGACCCGTGACATGTCAGGAGTTACAAAGGCCA
CTGTGACAGTTGAACGTAGTAGTAGCGCACCGGGGAAAGTCTTAGACGGGTTAATACGCAGGTGGGATCTAAACTTCTTC
AAAAACAGCAAATAA