Details for Capsella Locus Carubv10016033m

Position : scaf_3 ( 5`- 3326852 .. 3328039 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016033m

Protein [Map View]
MEAAAEAVSAAKEQSLILKGKRTKRQRPQSPIPFSIIPPMSSQEPDAEEESTSLVSKEQNLNDESNNNNNNIKNDNNTLI
NGVTSSSSASSSSNNNATLKATVDEEDQDMANCLILLAQGHSLPQHQPQPHLQQQTRQLMISYQESGNNNNAYRSSSRRF
LETSPSNGGGRAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKAATGLHSSHDLKKSIYDDPVSLHLNNVVTTAPNSNSN
HRSLVVYGKANNSNKVHECGICGAEFTSGQALGGHMRRHRGAVVATAAASTATLAVAATPVTANTALSLSPMSFDKMSEG
PVQVPVKRARSAVVSLDLDLNLPAPEDENRVNGGLSLASKQEQEHEHEQTQQNQQREEQKSIVLSSAPTLVDCHY*

DNA
ATGGAAGCAGCTGCGGAGGCTGTATCAGCCGCTAAGGAGCAATCATTGATCCTTAAAGGGAAACGGACTAAGCGGCAACG
CCCGCAGTCCCCAATCCCTTTCTCTATCATCCCTCCTATGTCTTCACAAGAACCAGATGCTGAAGAAGAATCCACTAGTC
TTGTTTCCAAGGAGCAGAATCTCAATGATGAGAGCAACAACAACAATAACAACATTAAGAATGATAACAATACTTTGATC
AATGGTGTTACATCTTCATCTTCAGCCTCTTCATCTTCCAACAACAATGCCACATTAAAGGCCACTGTTGACGAGGAAGA
TCAAGATATGGCTAATTGTTTGATCCTCCTCGCCCAAGGCCACTCTCTTCCCCAGCACCAACCGCAACCTCACCTTCAAC
AACAAACAAGACAGCTTATGATAAGTTACCAAGAATCTGGTAACAACAACAATGCGTATAGATCTAGCAGCAGGAGGTTT
CTGGAGACATCTCCATCGAACGGTGGAGGCAGAGCCGGCTACTATGTTTACCAGTGCAAAACATGTGACCGTACTTTTCC
GTCATTCCAAGCTCTCGGCGGCCATAGGGCCAGCCACAAGAAGCCTAAAGCCGCCACGGGCCTTCACTCCAGTCATGACC
TCAAGAAGTCTATCTACGATGACCCCGTTTCCCTTCATCTCAACAACGTTGTCACCACAGCTCCTAACAGCAATAGTAAC
CATAGATCGCTTGTGGTATACGGTAAAGCTAATAATAGTAATAAGGTCCATGAATGTGGAATATGTGGAGCCGAATTCAC
GTCCGGACAAGCATTAGGTGGTCATATGAGGCGACATAGAGGTGCAGTGGTGGCCACAGCAGCTGCCTCTACGGCCACCC
TAGCGGTTGCGGCAACTCCAGTTACTGCAAACACGGCTTTGTCACTGTCGCCTATGTCGTTTGATAAGATGTCGGAAGGT
CCGGTTCAGGTTCCGGTTAAGAGAGCGAGGAGTGCGGTTGTGTCGTTAGATTTAGATCTGAATCTACCTGCCCCGGAAGA
TGAGAATAGGGTCAACGGTGGATTAAGCTTAGCTTCAAAGCAAGAACAAGAACATGAACATGAACAAACACAACAGAATC
AACAGAGAGAAGAACAAAAGTCTATTGTCTTGTCTTCTGCTCCTACTTTGGTGGACTGCCATTACTGA