Details for Capsella Locus Carubv10016030m

Position : scaf_3 ( 5`- 3841473 .. 3843192 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016030m

Protein [Map View]
QMDHEEEEEIEIPNYFICPISLEIMKDPVTTVSGITYDRQCIVKWLEKVPSCPVTKQPLPLDSDLTPNHMLRRLIQHWCV
ENETRGVVRISTPRAPPGKLNVVEEIKKLKKLGLEALRREDTLQKLEVLAMEGNNRRFMCEAGVHKSLILLVVKCTSEEE
EGRRGIKELDESLRLLHLIGVPSNDAKTILMENDRIMESLTWVLHQQDFFNKAYTVLLLRNLTEYTSSHIVERLNPEVFK
GIIRFLKDVVKSPNLTSPSVSDTVQSSRPSLGKTEPSKHDHSLVIKQAVTSALMILLETSSWSRNRSILVDLGAISELIE
LEMSYTGEKRMTELMLGVLSRLCCCANGRADFLAHRGGIAVVTKRLLRVSPAADDRALSILSTVSKFSPENMLVEELVNV
GTVEKLCTVLRVDCGLNLKEKAKEILKDHFDEWKKFPCIDMTLLTKLLSSSPKDQLNEFYSRVGV*

DNA
CAAATGGATCATGAGGAGGAAGAAGAGATCGAGATCCCTAATTACTTTATCTGCCCAATCTCACTTGAGATCATGAAAGA
TCCAGTCACGACCGTTTCTGGCATCACCTACGATCGCCAATGCATCGTTAAATGGCTCGAAAAGGTCCCCTCTTGTCCCG
TCACGAAGCAACCACTTCCCTTAGACTCCGATCTTACTCCTAACCACATGCTTCGCCGTCTCATCCAGCACTGGTGTGTA
GAGAACGAGACTCGCGGCGTTGTCAGAATATCAACACCTCGAGCTCCTCCCGGGAAACTTAATGTTGTCGAGGAGATCAA
GAAACTCAAAAAGCTCGGCCTAGAAGCGTTACGAAGAGAAGATACGTTGCAGAAGCTTGAAGTTTTGGCAATGGAGGGAA
ATAACAGGAGATTTATGTGTGAAGCTGGCGTACATAAGTCTTTGATCTTGTTAGTAGTCAAGTGCACTAGCGAAGAAGAA
GAGGGACGACGTGGTATCAAAGAGCTAGATGAGTCTCTTCGTCTTCTTCACTTGATCGGTGTTCCATCAAATGACGCAAA
AACAATCTTGATGGAAAACGATCGAATCATGGAATCGTTGACTTGGGTTTTACACCAACAAGACTTCTTCAATAAGGCGT
ACACGGTTTTGCTATTGAGGAATCTAACGGAATACACTTCCTCTCATATAGTGGAGAGATTGAATCCCGAGGTTTTCAAA
GGGATCATAAGGTTTCTCAAGGATGTAGTAAAGAGTCCTAATCTGACGAGCCCTAGCGTGAGTGATACGGTACAATCTTC
AAGACCTAGCTTGGGAAAAACGGAACCATCAAAACATGATCATAGTTTGGTCATCAAACAAGCGGTGACCTCCGCGCTGA
TGATTCTTTTAGAGACTTCTTCGTGGAGCCGAAACCGATCGATCCTAGTTGATCTCGGTGCGATTTCTGAACTCATCGAG
CTCGAAATGAGCTACACAGGAGAGAAGAGAATGACAGAACTTATGTTAGGAGTTTTGTCTCGTTTATGTTGTTGCGCCAA
TGGTAGAGCCGATTTTCTTGCTCATAGGGGCGGAATCGCGGTTGTCACAAAGCGGTTACTGAGAGTTTCACCTGCAGCAG
ACGATAGAGCTCTATCTATCCTAAGCACTGTCTCAAAATTCTCGCCAGAAAACATGCTTGTGGAAGAGTTGGTAAACGTG
GGGACAGTGGAGAAGCTCTGTACCGTTCTAAGAGTTGATTGTGGTCTGAATTTGAAGGAGAAAGCTAAAGAGATACTTAA
AGATCATTTTGATGAATGGAAGAAGTTTCCTTGTATTGATATGACTCTACTTACTAAGCTTCTAAGTTCCTCACCCAAAG
ATCAACTCAACGAGTTTTACTCACGAGTTGGTGTTTAG