Details for Capsella Locus Carubv10016026m

Position : scaf_3 ( 5`- 2236789 .. 2238357 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016026m

Protein [Map View]
MSQPNNQANNDHDTRFTKIFIGNLTWRTTSDDLITHFGRFGEVVHANVVCETYPGRSKGYGFVTFRDSDSAARALENKNP
VIDGRTTNCQLATLGARKKINPPNQNGSLLNQVRPPQQYQPRPVHTHWPYGLPSIPQHNLQQTNMRHAVAYAPQESSVQL
NEIINDTDQESAPQRSSVRTENINETTDQELTADVAHHDNEEAATKPAGDVDQPTATDQEGGKNASDEERKINDQEDITK
QDDMSMKRSTNDIKNEKICKQG*

DNA
ATGTCTCAACCTAATAATCAAGCTAACAATGATCATGATACTAGGTTTACAAAGATCTTTATAGGAAATTTAACATGGAG
AACAACATCAGATGATTTGATAACACACTTCGGACGATTCGGAGAGGTTGTTCATGCTAATGTTGTTTGTGAAACTTATC
CTGGAAGATCTAAAGGCTATGGTTTTGTTACTTTTAGAGACTCTGATTCTGCAGCTAGAGCTCTTGAGAATAAGAATCCA
GTCATTGATGGGAGAACAACCAATTGCCAATTGGCTACTCTTGGTGCTAGGAAAAAAATTAATCCTCCTAACCAAAATGG
ATCATTATTGAATCAGGTGAGACCACCGCAGCAATATCAGCCACGACCTGTACATACCCATTGGCCCTATGGTTTACCAT
CCATACCGCAGCACAATTTGCAACAGACAAACATGCGACATGCCGTTGCTTATGCGCCTCAAGAGTCATCGGTTCAACTT
AATGAAATCATCAATGATACTGATCAAGAATCTGCGCCTCAAAGATCATCGGTTCGGACTGAAAACATCAACGAAACTAC
TGATCAAGAACTCACAGCGGATGTTGCACATCACGACAATGAAGAGGCGGCTACAAAACCAGCTGGTGATGTTGATCAAC
CAACGGCAACCGATCAAGAAGGAGGGAAAAATGCAAGTGATGAAGAAAGAAAGATCAATGACCAAGAAGATATCACCAAG
CAAGATGATATGTCGATGAAGAGATCAACTAATGACATCAAGAATGAAAAGATATGTAAACAAGGGTGA