Details for Capsella Locus Carubv10015998m

Position : scaf_3 ( 5`- 13460692 .. 13461966 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015998m

Protein [Map View]
MGKVPPSFRSIPTNQLMKKPTPSPPAPPRDYRNRTAVRDSTRLPQNTQPPPREPFRNPFKSPSLSDAKSLFNSIATTSRI
PLDLKFHNSVLQSYAAIAAVDDTVKLFQHILKSQPKFSPGRSTFLILLSHACRATDSSIADVHRVLNLMVNSGCEPDQVT
TDVVVRSLCETGRIDEAKDLMKELTEKHSPPDTYTYNFLLKHLCKCRSLRVAYDFTIMIDHVCNSKDLREAMFLVDQLGN
AGFKPDCFVYNTIMKGYCTLSKGSEAVGVYKKMKEEGVEPDRVTYNTLIFGLSKSGRVEEARRYLKTMVDAGFEPDAATY
TSLMNGMCRKGESLGALSLLEEMEAKGCAPNDCTYNTLLHGLCKARLMDKGMELYELMKSNGVKLESNGYGTLVRSLVKT
GKVAEAYE

DNA
ATGGGGAAAGTTCCGCCGTCGTTTCGCTCTATTCCGACGAACCAATTGATGAAGAAACCCACACCATCTCCTCCAGCGCC
GCCGCGTGATTACCGCAACAGAACCGCCGTGAGAGATTCAACTAGACTCCCCCAGAATACTCAACCCCCTCCTCGCGAGC
CTTTTAGGAACCCATTCAAGTCACCAAGTCTATCAGACGCCAAAAGCCTCTTCAATTCAATCGCCACCACTTCGAGAATC
CCACTCGATCTCAAATTCCACAACTCTGTTCTTCAATCCTACGCAGCAATCGCCGCCGTCGACGATACGGTGAAACTGTT
TCAGCACATCTTGAAATCTCAGCCTAAGTTCTCCCCTGGGCGTTCCACGTTTCTTATCTTGCTCTCGCATGCTTGCAGAG
CTACTGATTCATCGATTGCGGATGTTCATAGAGTTCTCAATCTCATGGTGAATAGTGGTTGTGAGCCTGATCAAGTAACA
ACTGATGTCGTGGTTCGATCTCTTTGCGAAACCGGTCGGATTGATGAAGCTAAGGATTTGATGAAGGAGCTGACTGAGAA
ACATTCACCTCCGGATACATATACTTATAACTTCTTACTGAAGCATTTGTGCAAATGCAGATCACTGCGTGTTGCTTATG
ACTTCACTATCATGATTGATCATGTTTGTAATTCTAAGGATTTGAGAGAGGCAATGTTTTTAGTTGATCAGTTAGGTAAT
GCTGGGTTTAAGCCCGATTGTTTCGTCTATAACACGATTATGAAAGGTTATTGCACACTGAGTAAAGGGAGTGAGGCGGT
TGGTGTTTATAAGAAAATGAAGGAAGAAGGTGTTGAGCCGGATCGTGTTACTTACAATACTTTGATATTTGGATTGTCGA
AATCTGGTAGAGTTGAGGAAGCTAGGAGGTACTTGAAAACTATGGTGGATGCGGGTTTTGAGCCAGACGCTGCCACTTAC
ACATCGCTGATGAATGGAATGTGTAGAAAAGGCGAATCTTTAGGTGCGTTGAGTTTGTTGGAAGAAATGGAAGCAAAAGG
ATGTGCTCCAAACGATTGCACTTATAATACTTTGCTTCATGGGTTGTGCAAGGCGAGGTTAATGGATAAAGGGATGGAGT
TATATGAGTTGATGAAATCAAACGGTGTAAAGCTTGAGAGTAATGGTTATGGTACGCTTGTGAGATCTCTGGTTAAAACT
GGCAAGGTGGCAGAGGCTTATGAA