Details for Capsella Locus Carubv10015986m

Position : scaf_3 ( 5`- 6543884 .. 6545092 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015986m

Protein [Map View]
MVSFSSCSPSYSSSAKKKTTMSIPQIQQTLFKKPSYASSSSSSSKATSLKKRQETVFKKAGELSVLCGIEVCVICYGADG
ELKTWPKEREKVKAIAQRYAALSETKRRKGSVDLHEFLEKINNDDSKKKTKKKKVRRVPKVKYPVWDPRFDNYSVEQLTG
LIQSLERNLTRIQHRVRAVVEGQGQRKIQYLSMANQGPMLPSTMNQYLQQQPNQVSMFLFNHGNGNISQIPVSASALNQG
QSLAPVPPELMIYPNLDVGNYSGSLGVQGTGISGFQNMNMNMLAYNNINSFDGFSKQIDQNSKVESYSSLLGAGIDELED
TNMYNHNNVNTGDYSGLLGTQGIVTNELNMSMHDYNNNNSVNANGLSHQFGQFQTQQQQGAFNWDQPGNNFRPLYDLPQP
LL*

DNA
ATGGTTTCTTTTTCATCCTGTTCCCCTTCGTATTCTTCATCGGCGAAGAAGAAAACAACGATGAGCATTCCCCAAATTCA
ACAAACCCTTTTCAAAAAACCTAGCTATGCTTCTTCTTCTTCTTCTTCTTCGAAAGCTACAAGCTTAAAGAAAAGACAAG
AGACCGTCTTTAAGAAAGCTGGCGAGCTTTCTGTTCTCTGTGGAATCGAAGTTTGCGTCATCTGTTACGGAGCGGACGGA
GAGCTTAAGACATGGCCAAAAGAGAGGGAGAAGGTCAAAGCCATCGCTCAAAGGTACGCTGCATTAAGCGAGACGAAACG
ACGCAAAGGAAGCGTTGATCTTCACGAGTTTCTCGAGAAGATCAATAACGATGATTCAAAGAAGAAGACGAAGAAGAAGA
AAGTGAGACGTGTTCCCAAAGTCAAGTATCCGGTTTGGGACCCTAGGTTTGATAACTACTCCGTGGAGCAACTCACGGGG
CTGATTCAGTCCTTGGAACGTAACCTAACCAGGATCCAACATAGGGTTCGCGCTGTTGTTGAAGGTCAGGGACAAAGGAA
GATCCAGTACTTGAGCATGGCTAATCAAGGACCGATGCTGCCTAGTACGATGAATCAATATCTTCAACAACAACCAAACC
AAGTTTCCATGTTTCTGTTTAACCATGGGAACGGTAATATCTCGCAAATCCCAGTCTCTGCATCAGCTTTGAACCAAGGG
CAATCTCTGGCTCCGGTTCCACCTGAACTGATGATTTACCCGAATTTGGATGTGGGAAATTACTCGGGGTCACTTGGGGT
ACAAGGAACTGGGATCAGCGGGTTTCAGAACATGAACATGAACATGTTAGCATACAACAACATCAACAGCTTCGATGGTT
TCTCAAAACAGATTGACCAGAATTCCAAAGTGGAAAGCTACTCGAGCTTACTTGGGGCTGGAATCGATGAGTTAGAGGAC
ACTAACATGTACAACCACAACAACGTCAATACAGGAGACTATTCAGGCCTACTTGGGACGCAAGGAATCGTGACTAACGA
GCTGAACATGAGCATGCACGACTACAACAACAACAACAGCGTTAACGCTAATGGCCTTTCGCATCAGTTTGGTCAGTTTC
AAACACAACAGCAGCAAGGGGCATTCAATTGGGATCAACCTGGAAACAATTTTAGGCCTCTCTATGATCTCCCACAACCT
CTCCTATAA