Details for Capsella Locus Carubv10015983m

Position : scaf_3 ( 5`- 3662565 .. 3663887 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015983m

Protein [Map View]
MERRNWPKFGDAANEEAGSHLTMVSTEEILLERPRAPGTKADDSKATGDGLSQLGKGAVLMVCRICHKKGDHWTSKCPYK
DLAAPTDAFIDKPPTGESSTVSAAPGTGKAAYVPPSMRAGADRSAVGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPF
GAVTRVYVAIDQKTGVSRGFGFVNFQSRDDAQRAINKLNGYGYDNLILRVEWATPRPT*

DNA
ATGGAGCGAAGGAACTGGCCGAAGTTTGGTGACGCAGCCAATGAGGAGGCTGGTAGCCATCTCACAATGGTTTCAACCGA
AGAGATTCTTCTAGAACGACCCAGAGCTCCTGGTACCAAAGCGGATGATTCAAAGGCAACAGGAGACGGCTTGTCTCAGC
TGGGTAAAGGTGCAGTTCTCATGGTGTGCAGGATATGCCACAAGAAAGGAGATCACTGGACATCAAAATGCCCTTACAAG
GATCTTGCTGCACCAACTGATGCCTTCATTGACAAACCACCCACAGGGGAATCATCTACCGTATCCGCTGCACCTGGAAC
TGGCAAGGCTGCATATGTCCCTCCTAGCATGCGAGCAGGTGCAGACAGAAGCGCTGTTGGTTCAGACATGAGGAGGAGGA
ACGATGAGAACTCTGTGCGTGTAACCAACTTGTCGGAAGATACCCGTGAACCAGACTTGATGGAGCTATTCCATCCGTTT
GGAGCTGTCACACGTGTCTACGTGGCCATTGATCAGAAAACTGGAGTGAGCAGAGGATTTGGTTTCGTCAACTTCCAGAG
CAGAGATGACGCTCAACGAGCAATCAACAAATTGAACGGTTATGGTTATGATAACCTCATCCTCAGGGTTGAATGGGCTA
CTCCAAGACCAACCTAG