Details for Capsella Locus Carubv10015967m

Position : scaf_3 ( 5`- 7321233 .. 7328418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015967m

Protein [Map View]
MEEIDDTEMESQVYMACIQHGRRVGVSYYDCSERKLHVLEFWEEDCSDFTLINMVKYQAKPSIIYTSTKSEESFVSALQQ
NDGADENTMVRLVKSSTFSYEQAWHRLVYLRVTGMDDGLNIKERICYLSSMMDVGSEVQVRVSGGLLAILESERIVETLE
QNESGTASIAIDSVMEVPLNKFLKLDAAAHEALQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPI
LDLEVLDRRLNAISFFISSVELMASLRETLKSVKDISHLLKKFNSPTSLCTSNDWTAFLKSISALLHVNKIFEVGVSESL
KEHMRRFNLDIIEKAGLCISTELDYIYELVTGVIDVTRSKERGYQTLVKEGFCAELDELRQIYEELPEFLQEVSAMELEH
FPHLHNEKLPPCIVYIQQIGYLMCIFGEKLDETALDRLIEFEFAFSDIDGETQRFFYHTPKTRELDNLLGDIYHKILDME
RAIIRDLLSHTLLFSAHLLKAVNFVAELDCILSLAYVAHQNNYVRPVLTIESLLDIRNGRHVLQEMAVDTFIPNDTEISD
SGRIHIITGPNYSGKSIYVKQVALIVFLSHIGSFVPADAATVGLTDRIFCAMGTKFMTAEQSTFMIDLHQVGMMLRQATS
RSLCLLDEFGKGTLTEDGIGLLGGTISHFATCTEPPRVLVCTHLTELLNESCLPVSEKIKFYTMSVLRPDTASANMEEIV
FLYRLIPGQTLLSYGLHCALLAGVPEEVVKRAATVLEAFKSNNIVERLSLEKISSQDQVFKDAVDKFMEFDISKGDIRSF
FQDIFTS*

DNA
ATGGAGGAAATAGACGACACAGAAATGGAATCACAGGTTTATATGGCTTGCATTCAGCATGGCAGGCGAGTTGGAGTTTC
TTACTACGACTGTAGTGAACGCAAGCTTCATGTGCTAGAATTTTGGGAGGAAGATTGCTCAGACTTTACCTTGATTAATA
TGGTAAAATATCAAGCGAAGCCATCAATCATTTACACAAGCACCAAAAGTGAAGAATCCTTTGTATCTGCTCTGCAGCAG
AATGATGGAGCTGACGAGAATACCATGGTGCGGCTGGTAAAGAGCTCAACATTCAGCTACGAGCAAGCGTGGCATAGACT
GGTATATCTTCGAGTAACAGGGATGGATGATGGGTTGAACATCAAAGAAAGGATTTGTTATCTTAGTTCGATGATGGATG
TAGGCAGTGAAGTCCAAGTTCGTGTTAGTGGGGGCCTTCTTGCGATATTAGAAAGTGAACGAATTGTTGAAACCCTGGAA
CAAAATGAATCTGGGACTGCGTCAATCGCAATTGATTCAGTCATGGAAGTACCATTGAACAAATTTCTTAAACTTGATGC
GGCTGCTCATGAGGCTCTGCAGATATTTCAAACAGATAAACATCCAAGCCATATGGGCATTGGCCGGGCCAAAGAAGGGT
TCTCGGTGTTTGGAATGATGAATAAGTGTGCCACCCCAATGGGTAGACGCCTTTTAAGAAGCTGGTTTATGAGACCAATT
TTAGACCTTGAAGTTTTAGATCGCCGCCTCAATGCTATTTCCTTTTTCATTTCTTCAGTAGAGCTGATGGCATCATTGCG
GGAGACACTAAAATCAGTGAAGGACATTTCGCATCTGCTCAAGAAATTCAACTCTCCAACGTCCCTTTGTACCAGTAACG
ACTGGACTGCTTTTCTGAAGAGTATAAGTGCCCTCTTGCACGTTAATAAGATATTTGAAGTTGGAGTTTCGGAAAGTCTC
AAAGAGCATATGAGACGCTTCAACTTGGACATTATTGAGAAGGCCGGCTTATGTATCAGCACAGAGCTAGATTATATCTA
TGAGCTGGTCACTGGGGTCATTGATGTAACTAGAAGCAAAGAGAGGGGTTATCAAACATTGGTGAAAGAAGGATTCTGTG
CTGAGTTGGATGAGCTGAGGCAAATATACGAGGAGTTGCCAGAGTTTCTGCAGGAGGTCTCAGCCATGGAGTTAGAACAC
TTTCCTCATCTGCATAATGAAAAGCTCCCCCCTTGTATCGTCTATATTCAACAAATTGGGTACCTCATGTGTATCTTTGG
AGAAAAGCTTGACGAAACTGCACTTGACAGGCTTATTGAATTTGAATTTGCGTTTTCGGATATAGATGGAGAGACTCAGC
GATTCTTTTATCATACTCCGAAGACACGAGAGTTAGACAACCTTCTTGGAGATATCTACCACAAAATTTTAGATATGGAG
AGGGCAATTATTAGGGACTTGCTATCACACACACTTTTGTTCTCGGCTCACCTGCTGAAGGCAGTTAACTTTGTTGCAGA
ACTTGATTGCATTCTATCACTGGCTTATGTTGCACATCAGAATAACTACGTCAGGCCTGTTCTGACAATAGAATCATTGC
TTGATATTCGAAATGGAAGACATGTGTTGCAGGAAATGGCTGTGGATACATTTATCCCGAACGACACTGAAATCAGTGAC
AGTGGCCGAATTCATATAATTACCGGTCCTAATTACTCAGGAAAGAGCATATATGTAAAGCAGGTGGCTTTAATTGTTTT
TCTATCTCATATTGGAAGCTTTGTACCAGCAGATGCAGCAACTGTTGGTTTAACTGACAGGATCTTTTGCGCAATGGGAA
CTAAGTTCATGACCGCGGAACAATCTACATTCATGATAGATCTGCATCAAGTAGGAATGATGCTCAGGCAGGCAACTTCA
AGATCTCTGTGTTTATTAGACGAGTTTGGTAAAGGCACTCTTACAGAAGATGGTATTGGCTTGCTTGGTGGGACAATTAG
TCACTTTGCTACATGTACAGAACCGCCAAGGGTTCTAGTGTGTACGCACTTGACTGAACTACTTAACGAGAGCTGTTTGC
CTGTTTCTGAGAAGATTAAATTCTATACAATGAGCGTTCTTAGGCCAGACACTGCATCTGCGAACATGGAAGAAATTGTT
TTTCTTTATCGGTTAATTCCAGGACAGACTTTGCTGAGCTATGGTCTTCATTGTGCACTACTCGCTGGTGTACCGGAGGA
AGTGGTGAAGAGAGCAGCCACCGTGTTGGAAGCCTTTAAAAGTAACAACATTGTCGAAAGACTGAGCCTTGAAAAAATAT
CATCTCAAGATCAAGTATTCAAGGATGCTGTTGACAAGTTTATGGAGTTTGACATCAGTAAAGGTGACATCCGTAGCTTC
TTTCAAGATATCTTCACTTCCTAA