Details for Capsella Locus Carubv10015964m

Position : scaf_3 ( 5`- 8607961 .. 8609127 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015964m

Protein [Map View]
MGFLLDLPFMFKAFRFRRLVVGDGRRRKKKKPSWLTPVSHGYYTVDRLSYTGNSSNDDSVFVQREQQNEDELEIWLFGVS
NALTGKEMVKYMQNHLFDKLPNELGVMRKCKETMRRAYAEEERTGGSAATVAVVNGEKLAMASIGGHRVVVCRDGEAHQI
RDKNRRSSTKHWSQFMFPVCNQGEAVDESDPRNSELVVITEKISSDTEFIIVGSSGIWEVMKNQEAINLIRHIEDPKEAA
KCLAKEALNRISKSSISCVVIRFD*

DNA
ATGGGCTTCTTATTAGATCTCCCTTTCATGTTCAAGGCGTTCCGGTTTAGGAGACTTGTAGTTGGAGATGGAAGGAGAAG
GAAGAAGAAGAAACCATCATGGTTAACTCCGGTTTCTCACGGATACTATACCGTTGACCGGTTAAGCTATACCGGCAATT
CGTCGAATGATGATTCAGTTTTTGTACAGAGAGAGCAGCAAAATGAAGACGAGCTTGAGATTTGGTTGTTTGGAGTTTCT
AATGCTCTAACAGGGAAAGAAATGGTCAAGTATATGCAAAACCATCTCTTTGATAAGCTCCCTAATGAGCTAGGAGTAAT
GAGAAAATGTAAAGAGACAATGAGAAGAGCGTATGCTGAGGAAGAGAGGACCGGTGGCTCAGCCGCTACGGTGGCTGTGG
TGAACGGAGAGAAGCTAGCCATGGCGAGTATCGGTGGCCATAGAGTGGTGGTTTGTAGAGACGGCGAGGCTCATCAAATC
AGAGACAAGAACCGGAGATCATCAACAAAACATTGGTCACAGTTTATGTTTCCAGTTTGTAATCAAGGAGAAGCAGTAGA
TGAATCAGATCCAAGAAACTCAGAACTTGTGGTTATTACAGAAAAGATTAGTTCAGATACTGAGTTTATCATTGTCGGTA
GCTCTGGGATTTGGGAGGTGATGAAGAATCAAGAAGCGATTAACTTAATTAGACACATAGAAGATCCTAAAGAAGCTGCA
AAATGTTTAGCTAAAGAAGCTTTAAACAGGATTAGCAAAAGTAGCATTTCCTGTGTTGTAATTCGGTTTGATTAA