Details for Capsella Locus Carubv10015962m

Position : scaf_3 ( 5`- 2327800 .. 2335240 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015962m

Protein [Map View]
MATNLGENEDVEVELELCLSLGGPFKKTEKSKPIDQFNNAVGCMKDTGFNLEGGTTNVTSRKETRKKQQRIGDERECKKS
RRECNGGMDLDLSFRKMGNGYGSGQLKEICKDVTFGSSPICTSSDVSDPSSSSPQQGGSGDYGTQSGQTKQVRPPVRNIL
TRTEEAVHSTDGSKDAVVVEKSQELSNSVSKNTGKPPKPYTNSNGNGSSLPFAQMPCVTSTGNGPEGKTVNGFLYRYSKS
EISIICVCHGTSFSPAEFIVHAGGTNVSHPLRHITVDVDAKDLNILSSGGFDSAVVTSFVSQHSHREGFLLVVDGHFTKK
FTQSLFLAPQENGYFVLTDEKVPETEEASEPNHGNIHESQAVTESASIHVKNLPPNATIALVENVFKQFGPIKKGGTRVK
NPTSNYSYGFVDFEEADAAIRAIKASPLSIDGHKTYVEKTKNRPDDYKSYSERAPDGPGNINRGQDVRGSQCNPYWNWQK
MMEEVRGTDVWQKLVMESRGTEVYDTRNWQRIMDKEQKKFQEVGNGFVEKYYHFLQNSPQILPRFYKDVSTVTRPGRDGV
MRASTLPDIIEDLDMLSSGGFDSVEVTSVVSQDSHSGGVFVVADGYFTLHEKPARNFTQNFFLAPQEKGYFVCNDVFKFV
DVSEANATIPSASDAVTERAAICIKNLPSDATIALVENAFKKFGKIRRGGIEVRNTRSFSYGLVEFKEEKAAQKAIKASP
IKLGLHSVYVERRRPDYMSYWEAPSSGPGNISRSVETRGTEAPGKNELYESSAVHVRNLPPNATTGWLRNVFVEFGPIRR
GGERVHNRGLNYRYGFVKFVKADAAERAIQASPVLIDGRRLQVRKKIDGRVHNLN*

DNA
ATGGCGACAAATCTTGGAGAAAATGAAGATGTGGAGGTGGAGCTCGAGCTATGTCTTTCTCTCGGAGGTCCTTTCAAGAA
AACAGAGAAATCTAAACCAATAGATCAATTTAATAACGCCGTCGGATGCATGAAGGATACCGGCTTTAATCTTGAAGGCG
GAACGACGAATGTGACGAGTAGAAAGGAAACGCGGAAGAAGCAGCAGAGAATCGGGGATGAACGAGAGTGCAAGAAGAGC
AGAAGAGAATGTAACGGAGGCATGGATTTGGATTTAAGCTTTAGGAAAATGGGTAACGGTTACGGGTCGGGTCAACTTAA
GGAAATATGTAAAGACGTTACGTTTGGGTCGTCACCCATTTGCACTTCCTCCGACGTATCCGATCCTAGCAGCTCTTCTC
CTCAACAAGGTGGAAGTGGCGACTATGGGACACAATCAGGCCAAACCAAACAGGTTAGACCTCCGGTTAGAAACATTCTT
ACCAGGACAGAGGAAGCTGTGCATAGCACAGACGGTTCAAAGGATGCGGTGGTAGTGGAGAAGTCCCAAGAATTGTCCAA
CTCTGTAAGCAAAAACACTGGGAAGCCGCCAAAACCGTATACCAACAGTAACGGTAACGGCAGCTCGCTTCCGTTTGCTC
AGATGCCTTGTGTGACTAGCACGGGTAACGGACCGGAGGGCAAAACCGTGAATGGATTTCTATACCGTTACTCAAAATCA
GAGATCAGTATAATCTGTGTCTGCCATGGAACGTCTTTCTCTCCGGCTGAGTTCATTGTTCACGCCGGTGGGACTAATGT
GTCACATCCGTTGAGACATATAACCGTTGATGTAGATGCCAAGGATCTTAATATCCTCTCTTCTGGTGGTTTTGATTCGG
CTGTGGTAACCAGCTTCGTGTCCCAACACTCTCATAGAGAGGGTTTCCTCCTCGTTGTTGATGGCCACTTCACAAAGAAG
TTCACACAATCTTTGTTTCTTGCTCCCCAAGAAAACGGCTACTTTGTTTTGACGGACGAGAAAGTTCCAGAAACAGAGGA
AGCTTCTGAACCAAATCATGGGAACATTCACGAGTCTCAAGCTGTAACTGAAAGTGCAAGCATTCATGTTAAAAACCTTC
CTCCAAATGCAACCATTGCATTGGTTGAGAATGTATTTAAGCAGTTTGGACCAATTAAAAAGGGAGGAACTCGAGTTAAA
AACCCTACTTCGAACTATTCGTATGGTTTTGTGGATTTTGAGGAAGCAGATGCTGCCATTAGGGCAATAAAGGCGTCTCC
TCTAAGTATTGATGGGCACAAAACTTACGTGGAGAAGACGAAGAATCGACCTGACGACTATAAAAGTTACAGTGAAAGAG
CACCCGATGGACCAGGAAACATAAACAGAGGCCAGGACGTGAGAGGATCACAATGTAACCCCTATTGGAACTGGCAGAAG
ATGATGGAGGAAGTGAGAGGAACAGACGTATGGCAGAAGTTAGTGATGGAATCGAGAGGAACAGAAGTTTATGATACCCG
GAACTGGCAAAGGATTATGGACAAGGAGCAGAAGAAGTTTCAGGAGGTGGGGAATGGTTTTGTAGAGAAATACTATCACT
TCTTGCAGAACTCCCCGCAGATTCTCCCTCGGTTTTATAAAGATGTCAGTACGGTTACTCGGCCTGGACGTGATGGAGTA
ATGCGTGCCTCCACCCTACCGGATATAATTGAGGATCTTGATATGCTATCTTCTGGAGGTTTTGATTCGGTTGAGGTAAC
CAGTGTCGTATCCCAAGACTCTCATAGTGGGGGTGTCTTCGTCGTTGCTGATGGCTATTTCACTTTACACGAGAAACCTG
CAAGGAACTTCACACAAAACTTCTTTCTTGCTCCCCAAGAAAAAGGCTACTTTGTCTGTAATGACGTGTTCAAGTTTGTT
GACGTATCCGAGGCTAATGCAACCATTCCTTCTGCTAGTGATGCGGTAACCGAGCGTGCAGCAATTTGCATTAAGAATCT
TCCTTCTGATGCAACCATTGCCTTAGTTGAGAATGCATTTAAGAAGTTTGGAAAAATTAGAAGAGGTGGAATTGAAGTTA
GAAACACAAGGAGCTTTTCTTATGGCTTGGTTGAGTTTAAGGAAGAAAAGGCCGCCCAGAAGGCAATAAAGGCGTCTCCT
ATAAAGTTAGGTTTGCATAGCGTTTACGTGGAGAGGAGGCGACCTGACTACATGAGTTACTGGGAAGCTCCATCCTCTGG
ACCAGGAAACATAAGCAGAAGCGTGGAAACGAGAGGAACAGAAGCTCCTGGTAAAAATGAGTTATATGAGTCTTCTGCAG
TTCACGTTAGAAATCTTCCTCCAAATGCAACCACTGGCTGGTTAAGGAATGTTTTTGTGGAGTTTGGGCCAATTAGAAGA
GGAGGAGAGCGAGTTCATAACCGTGGTTTGAACTATAGGTATGGTTTTGTGAAGTTTGTGAAAGCAGATGCAGCCGAGAG
GGCAATACAGGCGTCTCCTGTATTGATTGATGGGCGAAGGCTTCAAGTCCGGAAGAAAATTGATGGGCGAGTGCATAATC
TAAACTGA