Details for Capsella Locus Carubv10015960m

Position : scaf_3 ( 5`- 4586298 .. 4586834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015960m

Protein [Map View]
MTNNGAVPTSSHASPMVDLESISRAKRRIKDGLATRRPWKVMFDFHSMGLPHGVSDAFSRIKTNLAYFRSNYAIVVLNVM
FFSLIWHPISLIIFAGLVFLWIFLYFLREEPLKIFRLQINDQAVLIGLSVITVASLLLLANATFSIVAALLTGAVLVLIH
ALVRKTEDLFLDEEAATT*

DNA
ATGACGAACAACGGCGCAGTTCCGACGTCTTCTCATGCATCTCCGATGGTGGATCTCGAGTCCATCTCTCGTGCCAAGCG
ACGTATCAAAGACGGACTCGCCACGCGACGTCCTTGGAAAGTGATGTTCGATTTCCACTCCATGGGGCTACCTCACGGAG
TCTCCGATGCTTTCTCGAGAATCAAGACGAATCTTGCTTACTTCCGTAGTAACTACGCAATCGTCGTCTTGAACGTCATG
TTCTTCAGCCTGATATGGCATCCGATCTCGCTCATCATCTTCGCCGGCTTGGTTTTCCTCTGGATCTTTCTTTATTTCCT
CCGTGAAGAGCCTCTCAAAATATTCCGACTTCAGATAAACGATCAGGCGGTCTTGATTGGTCTATCGGTGATAACCGTCG
CTAGTCTCCTCTTGCTCGCTAACGCGACGTTTAGTATAGTTGCGGCGTTGCTTACCGGAGCTGTGTTGGTTCTGATCCAT
GCGTTGGTTAGGAAGACGGAGGATCTTTTCTTGGATGAAGAGGCCGCGACGACTTAA