Details for Capsella Locus Carubv10015955m

Position : scaf_3 ( 5`- 5497176 .. 5497679 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015955m

Protein [Map View]
MRDLNNNVVKTIARWCLVLQAIMISSNAVALEEPGYVYMNVTIRNAMTGLIRPEIVYRCQSKRKDYGWHRASKPGAQFSF
PIILIDGESKIPAIHICEIRSALGKATLVIENTYLDAKMCPHSSCAHEATPKGIVFRGLELDFKELFPKPKPVEYLELPW
TSWPNRT*

DNA
ATGAGGGATCTTAACAACAACGTCGTCAAAACCATAGCTCGATGGTGTCTTGTTCTACAAGCAATCATGATCTCTTCTAA
CGCGGTGGCTCTCGAGGAACCCGGCTATGTATACATGAACGTAACAATCCGTAACGCAATGACAGGATTAATCCGCCCCG
AGATAGTCTATCGTTGCCAGTCTAAACGCAAAGACTATGGCTGGCATCGAGCTTCAAAGCCAGGAGCTCAATTTTCATTC
CCAATCATCCTCATAGATGGCGAAAGCAAAATACCGGCGATCCACATCTGCGAGATCCGGTCTGCCTTAGGAAAAGCCAC
ACTCGTGATCGAAAACACCTATCTTGATGCTAAGATGTGCCCTCATTCGTCATGTGCTCACGAGGCAACCCCGAAAGGGA
TCGTGTTTAGAGGCCTAGAATTGGATTTCAAAGAATTGTTCCCAAAGCCCAAACCAGTTGAGTATCTAGAATTGCCCTGG
ACATCTTGGCCAAACAGAACGTGA