Details for Capsella Locus Carubv10015953m

Position : scaf_3 ( 5`- 1823977 .. 1824717 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015953m

Protein [Map View]
MVSETVSKTESPPLIGPRISFSADLSDDGDFICISPVMCKELEKDVVLKGSVKVSDFEFLSENVSPQKMLTADELFSEGK
LLPYWQVKHSEKLKNITLKTNEEEEENRKAEVMKKDQEITSNNRVSWFIDEDPSPRPPKCTVLWKELLRLKKQRNPSSSS
VTVRTVSSLSPSSSTSSSSSLEDAAKREEREKERKRGKKGLERTRSASMRIRPMIHVPICTPSKSSLPLPPLFPLALKKN
RVERRA*

DNA
ATGGTTTCGGAGACGGTTTCAAAGACGGAATCACCACCGTTGATTGGACCTCGTATATCCTTCTCAGCTGATTTATCCGA
CGATGGTGATTTCATCTGCATCAGCCCCGTAATGTGTAAGGAGTTAGAGAAAGATGTCGTCCTCAAAGGGTCAGTGAAAG
TCTCCGACTTTGAGTTCTTGTCTGAAAATGTGAGTCCACAGAAGATGCTTACCGCCGACGAGCTCTTCTCTGAAGGCAAG
CTGCTTCCCTATTGGCAAGTAAAGCACTCGGAGAAGCTTAAAAACATTACCCTGAAGACGAACGAAGAAGAAGAAGAGAA
CCGTAAAGCAGAAGTGATGAAGAAAGATCAGGAGATTACTAGTAATAACAGAGTGAGTTGGTTTATTGACGAAGATCCAT
CTCCTCGTCCTCCCAAGTGCACGGTTCTTTGGAAAGAGCTTTTGAGATTGAAGAAACAGAGGAATCCGTCTTCGTCTTCG
GTTACGGTGAGGACGGTGTCGTCTTTGTCTCCGTCATCGTCAACCTCATCATCAAGCTCGCTTGAGGATGCCGCGAAGAG
AGAGGAGAGAGAGAAAGAGCGGAAGAGAGGTAAGAAAGGATTGGAAAGAACGAGATCGGCGAGTATGAGGATAAGGCCGA
TGATTCATGTTCCTATTTGCACTCCTTCTAAGTCATCTCTTCCACTACCTCCTCTGTTCCCACTTGCGCTTAAGAAAAAC
AGAGTAGAGAGACGAGCTTAA