Details for Capsella Locus Carubv10015946m

Position : scaf_3 ( 5`- 3268860 .. 3271183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015946m

Protein [Map View]
MATLSSSRLYSSSPLCKSRFSPTTLVSGIDFISFSPRATLSSSSLVSPAIFSLSVKHSRRRSSLQVKSVASPTETVSEFD
EMVSGTKRKYYMLGGKGGVGKTSCAASLAVRFANNGHPTLVVSTDPAHSLSDSFAQDLTGGMLVPVEGPEAPLFALEINP
EKAREEFRTASQMNGGTGVKDFMDGMGLGMLVEQLGELKLGELLDTPPPGLDEAIAISKGHTLRLLSLPDFLDASIGKIL
KLRQKITSATSAIKSVFGKEENKADAADKLERLRERMVKVRELFRDTESTEFVIVTIPTVMAVSESSRLSASLKKESVPV
KRLVVNQILPPSSSDCKFCSIKRKDQMRALDMIREDSELSALTLMEAPLVDMEIRGVPALRFLGDIIWK*

DNA
ATGGCAACTCTGTCTTCATCTCGATTGTATTCTTCTTCTCCTCTTTGCAAATCTCGATTCTCACCAACAACTCTCGTATC
GGGGATTGATTTTATCTCTTTCTCCCCTCGAGCAACTCTCTCCTCCTCATCCCTTGTCTCGCCGGCGATTTTTTCTCTCT
CCGTTAAACATAGTCGCCGGAGAAGCTCGCTCCAAGTGAAATCAGTAGCTAGCCCAACGGAGACAGTGTCGGAATTTGAT
GAGATGGTCTCCGGCACGAAACGAAAGTATTACATGCTCGGTGGGAAAGGAGGAGTGGGCAAAACTAGTTGTGCTGCTTC
TTTAGCTGTGAGATTTGCCAACAATGGACACCCAACTCTTGTTGTATCCACAGATCCAGCACATTCCTTGAGTGATTCTT
TTGCTCAGGACTTGACTGGAGGAATGCTTGTACCCGTAGAAGGGCCTGAAGCTCCTTTATTTGCTCTAGAAATAAACCCT
GAGAAGGCCAGGGAAGAGTTTCGTACTGCCTCCCAGATGAATGGAGGAACTGGGGTCAAAGATTTTATGGATGGTATGGG
ACTTGGGATGCTTGTAGAACAGTTGGGAGAGCTTAAACTTGGAGAATTGCTCGACACACCGCCTCCTGGATTGGATGAAG
CCATTGCCATTTCTAAGGGTCATACGCTAAGGCTACTCTCTTTACCTGATTTCTTGGATGCATCCATTGGTAAAATCTTG
AAGCTTAGACAAAAAATAACCTCGGCTACTTCAGCGATCAAATCAGTCTTTGGGAAAGAAGAAAACAAAGCTGATGCTGC
CGACAAATTGGAACGACTAAGAGAAAGGATGGTTAAAGTTCGTGAGCTTTTCCGTGACACAGAGTCAACAGAATTTGTCA
TAGTGACTATCCCAACGGTAATGGCGGTCAGCGAGTCTTCTAGGTTAAGTGCTTCCTTGAAGAAGGAAAGTGTTCCCGTC
AAAAGACTCGTTGTTAATCAGATTCTCCCACCTTCCTCCTCAGACTGCAAATTTTGCTCAATTAAGAGAAAGGATCAAAT
GCGTGCTCTTGATATGATCCGGGAGGATTCAGAACTCTCTGCTTTGACACTGATGGAGGCTCCGCTGGTAGATATGGAGA
TCAGAGGTGTCCCTGCCCTGCGCTTCTTGGGGGATATCATTTGGAAATAA