Details for Capsella Locus Carubv10015940m

Position : scaf_3 ( 5`- 3256768 .. 3258431 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015940m

Protein [Map View]
MRQNLKKVAQIKVDESKKLFPYVLGWKSSCGNCAKRSKPKLIYLLIFSLISSCFVFAPQLLYFPYPSALFLIDSSIKEID
NRVSESNIESPKTSQNDESISCDRTGYRTDICFMKGDIRTHSPSSIFLYTSNDLTDHVLQETIKPYTRKWETSIMDTIGE
LKLMEKDAKLSGDKHKCQVIHEVPAVIFSTGGYTGNLYHEFNDGLIPLYITSKRFNKKVVFVIADYHRWWEMKYGDVLSQ
LSDYPLIDFNKDKRAHCFKEAIVGLRIHGDLTVDPSQMQDGNTTINEFRNVLDRAYRPRINRLDRQEEQRFHARVAKRRK
AQRPKLALFSRTGSRGITNEALMVKMAQRIGFEVEVLRPDRTTELAKIYRVVNSSNVMVGVHGAAMTHFLFMKPGGVFIQ
IIPLGTDWASETYYGEPAKKLGLDYIGYKILARESSLYEKYDKNDRILRDPNSITRKGWQFTKGIYLNDQKVRLDLHRFK
KVLVDVYAKSIS*

DNA
ATGAGGCAGAATCTGAAAAAAGTAGCACAGATCAAAGTAGACGAATCTAAAAAGCTGTTTCCTTATGTCTTGGGGTGGAA
AAGTTCTTGTGGGAATTGCGCAAAGAGATCAAAGCCTAAGCTTATCTATCTTCTTATCTTCTCTCTTATCTCAAGTTGCT
TCGTCTTTGCCCCTCAGCTCCTTTATTTCCCTTACCCCTCTGCTCTGTTTCTTATCGATTCTTCAATTAAAGAGATTGAT
AATCGGGTTTCCGAAAGCAATATAGAATCACCTAAGACCTCGCAAAATGACGAGAGCATATCTTGTGACAGAACCGGGTA
TCGTACAGACATCTGTTTCATGAAAGGCGATATCAGAACACACTCTCCTTCCTCCATCTTTCTCTACACCTCTAATGATC
TCACCGATCACGTCTTGCAAGAAACCATCAAACCGTACACCAGAAAGTGGGAAACTAGTATAATGGACACCATTGGTGAG
CTGAAACTTATGGAAAAAGATGCTAAGCTTTCTGGTGACAAGCATAAATGCCAAGTAATCCATGAAGTACCAGCAGTGAT
ATTCTCTACCGGAGGTTATACCGGAAACCTCTATCATGAGTTCAACGACGGGCTTATCCCATTGTATATAACATCTAAAC
GTTTCAACAAAAAGGTTGTCTTTGTGATTGCTGACTATCACAGGTGGTGGGAGATGAAGTATGGAGATGTTCTCTCTCAG
CTCTCTGATTATCCTCTTATTGATTTCAACAAAGACAAGAGAGCTCACTGCTTCAAGGAAGCCATTGTTGGCCTCAGAAT
CCATGGTGACTTAACCGTCGATCCTTCTCAGATGCAAGATGGCAACACAACCATCAATGAGTTCAGAAATGTACTTGATC
GAGCCTATAGACCTCGAATCAACAGATTGGACAGGCAAGAGGAGCAACGGTTCCACGCGAGAGTAGCAAAGAGAAGAAAG
GCTCAGAGGCCAAAACTAGCATTGTTTTCAAGAACCGGGTCTCGTGGTATAACAAACGAGGCTCTGATGGTGAAAATGGC
TCAGAGGATCGGGTTTGAAGTCGAGGTTCTGAGACCTGACAGAACAACGGAATTGGCAAAGATTTACAGAGTGGTTAACT
CAAGCAATGTCATGGTTGGGGTACATGGAGCAGCCATGACGCATTTTCTATTCATGAAACCTGGAGGTGTCTTTATTCAA
ATCATTCCACTGGGAACAGATTGGGCATCAGAAACATATTATGGAGAACCGGCTAAGAAGCTCGGTCTAGACTACATTGG
TTATAAGATTCTTGCAAGAGAGAGCTCATTGTATGAAAAATATGATAAAAATGATCGAATTCTAAGAGACCCAAACAGCA
TCACTCGCAAAGGATGGCAATTCACGAAGGGGATATACCTGAACGACCAGAAAGTGAGGTTAGATCTCCATAGATTCAAG
AAGGTTTTGGTTGATGTGTATGCAAAATCGATTAGCTGA