Details for Capsella Locus Carubv10015910m

Position : scaf_3 ( 5`- 3383735 .. 3385210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015910m

Protein [Map View]
MDQPTPDRSKRQWKFSTFVYFSSILFLLLSIFVLDFTTTDLYKFQSLRFTFTANRIYSYLQFLLGFYNGTPDSNSETVNP
GSSTSHCVLWMAPFLSSGGYSSEAWSYILSLRRNLTHPRFRITIEHHGDLESVEFWNGLAKETKELAVELYRTQCRPNET
IVVCHSEPGAWYPPLFETLPCPPTGYEDFLSVIGRTMFETDRVNPEHVERCNQMDHVWVPTEFHVSSFVQSGVDSSKVVK
IVQPIDVAFFDPSKYEPLDLMAIGDLVLGSKMKNSGLGFVFLSVFKWEQRKGWDVLLKAYLREFSGKESVALFLLTNAYH
SDSDFGNKILDFVEELNIEEPRNGYPFVYVIDKHVAQVDLPRLYKAADAFVLPTRGEGWGRPIVEAMAMSLPVIATNWSG
PTEYLTEQNGYPLVVEEMSEVEEGPFEGHQWAEPSVDKLRVLMRHVMSNPDEAKVKGKRGRDDMMQKFAPEVVAKVVADQ
IERIFDEKIRT*

DNA
ATGGATCAACCAACACCAGATCGGAGCAAGCGACAATGGAAATTCTCGACGTTCGTCTACTTTTCATCGATCTTATTCCT
TCTTCTTTCCATATTCGTACTCGACTTCACTACGACTGATCTCTACAAATTCCAAAGTCTGAGATTCACCTTCACAGCGA
ACCGCATCTATAGCTATCTTCAATTTCTTCTAGGGTTCTACAACGGAACTCCCGATTCCAATTCCGAAACGGTGAACCCA
GGTTCTTCTACGTCCCATTGCGTGTTATGGATGGCACCTTTCCTCTCGAGTGGTGGTTATAGCTCAGAAGCTTGGTCTTA
CATTTTGTCACTTCGTCGAAATCTCACACACCCGAGATTTCGAATCACCATCGAGCACCATGGCGATCTGGAATCGGTGG
AGTTTTGGAATGGTTTAGCTAAGGAGACTAAAGAGCTAGCGGTGGAGTTGTACAGAACACAGTGTAGACCCAATGAGACG
ATCGTTGTTTGTCATAGCGAGCCTGGCGCTTGGTATCCACCATTGTTCGAGACTCTTCCTTGTCCTCCCACTGGTTACGA
AGATTTCTTATCTGTGATTGGTAGAACAATGTTTGAGACTGATAGAGTCAATCCAGAGCATGTAGAGCGATGTAACCAGA
TGGATCATGTTTGGGTTCCTACTGAGTTTCATGTCTCTTCTTTCGTACAAAGTGGGGTTGATTCTTCTAAGGTTGTCAAG
ATTGTGCAGCCTATTGATGTTGCCTTCTTCGATCCGTCAAAGTATGAGCCTTTGGATCTGATGGCGATTGGGGATTTGGT
TTTGGGTTCCAAGATGAAGAACTCGGGTTTGGGGTTTGTGTTCTTGAGTGTGTTTAAGTGGGAGCAGAGAAAAGGTTGGG
ATGTGTTGTTGAAAGCTTACCTGAGAGAGTTCTCTGGTAAAGAAAGTGTTGCTCTGTTTTTGTTGACAAACGCATATCAC
TCGGATAGTGATTTCGGGAACAAGATTCTAGATTTCGTAGAAGAACTGAATATAGAAGAGCCTAGAAATGGTTACCCTTT
TGTGTATGTGATTGACAAACACGTAGCTCAAGTTGATTTGCCTCGGTTGTACAAAGCGGCTGATGCGTTTGTCTTGCCTA
CAAGAGGCGAAGGATGGGGACGACCGATAGTGGAAGCCATGGCAATGTCTTTGCCTGTGATAGCAACAAACTGGTCAGGA
CCAACAGAGTATCTGACAGAGCAGAATGGTTACCCGTTGGTGGTTGAGGAGATGAGTGAAGTAGAGGAAGGTCCTTTTGA
AGGGCATCAATGGGCAGAGCCATCTGTCGATAAGCTTAGGGTTCTAATGAGGCATGTAATGAGTAATCCAGATGAGGCTA
AGGTTAAAGGAAAGCGTGGAAGAGATGACATGATGCAGAAGTTTGCTCCTGAAGTTGTTGCTAAGGTTGTTGCAGATCAA
ATCGAGAGGATCTTTGATGAGAAAATAAGAACATGA