Details for Capsella Locus Carubv10015908m

Position : scaf_3 ( 5`- 5572424 .. 5573078 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015908m

Protein [Map View]
MSSKQGGKLKPLKQPKSGKKEYDEHEMELMQKKKDEEKALKELRAKASQKGSFGGTGLKKSGKK*

DNA
ATGTCGTCCAAACAAGGAGGGAAATTGAAGCCATTGAAGCAGCCTAAGTCTGGTAAGAAGGAGTACGATGAGCACGAAAT
GGAGTTAATGCAGAAAAAGAAGGATGAAGAGAAGGCACTTAAAGAACTCAGGGCCAAGGCGTCACAAAAAGGATCATTTG
GAGGCACAGGACTTAAGAAGAGTGGGAAGAAATAA