Details for Capsella Locus Carubv10015895m

Position : scaf_3 ( 5`- 4318766 .. 4319419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015895m

Protein [Map View]
MDQIKPEFLKNLTKFILLSIWVVSLLVTHNFYLYRFTIQLVTHAVDKNYMFLLCNGLLMVVAKCSGLVATASKPVETKYS
TSNTDHKSFDYRDFKSYGTILELEHYSSSVHHGIGGGGTESFLAEEVTVQEDNDDTTHQEAEMNEEGEDNDDSLADNDDG
EEEWDLRDGFINEEEEEEENVELLAATEEEMNKKFDEFIRKMKEELRIEAKRHLILV*

DNA
ATGGATCAAATAAAACCGGAGTTTCTGAAGAATTTAACCAAGTTCATACTACTCTCGATATGGGTTGTATCTCTTTTAGT
AACCCACAACTTCTATTTATATAGATTCACCATTCAACTCGTAACACATGCAGTAGATAAGAACTACATGTTCCTTCTCT
GCAATGGTCTCTTGATGGTTGTTGCCAAGTGCTCTGGTTTGGTCGCTACTGCCTCAAAACCAGTAGAGACAAAGTACTCG
ACTAGTAACACTGATCATAAATCCTTTGATTACCGAGATTTCAAGAGTTACGGTACGATACTAGAGCTAGAGCATTACTC
TTCTTCTGTTCATCATGGAATAGGAGGAGGAGGAACAGAGTCCTTCCTTGCGGAGGAAGTTACTGTGCAGGAGGACAATG
ACGATACAACACATCAAGAAGCCGAAATGAACGAAGAAGGTGAAGACAACGACGACTCGTTAGCAGATAATGATGACGGA
GAGGAAGAGTGGGATCTTCGTGACGGATTTATAAATGAAGAAGAGGAAGAGGAAGAGAACGTAGAGTTGTTGGCAGCGAC
GGAGGAAGAGATGAATAAGAAGTTCGATGAGTTCATCAGAAAGATGAAGGAAGAGCTTAGAATCGAAGCCAAACGTCATT
TAATCCTTGTTTGA