Details for Capsella Locus Carubv10015892m

Position : scaf_3 ( 5`- 9334199 .. 9334775 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015892m

Protein [Map View]
MAKMKAQGGGEEGVTSTRFDPKKTIKVLEPEKQETNEEKAKSEPSKGKATLLRMKELIKWAAAAKSDKAAKFFTPKIMME
LRNRKKLKMMRSEVNDEESRKRLSSVSTNNISLRWESSESCTTHSSSSDQISIVSSPAILVSLGHTPLYQCRSKKGNWIT
TDSE

DNA
ATGGCAAAGATGAAAGCACAAGGAGGAGGAGAAGAAGGAGTGACATCGACAAGGTTTGATCCGAAAAAGACTATCAAAGT
CTTGGAACCGGAGAAACAAGAAACCAACGAAGAGAAGGCGAAAAGCGAACCGAGCAAAGGTAAGGCCACACTTTTAAGAA
TGAAGGAGCTCATCAAATGGGCAGCAGCAGCTAAATCCGACAAAGCTGCCAAGTTCTTCACCCCTAAGATAATGATGGAG
TTGAGAAACAGAAAAAAGTTGAAGATGATGAGATCAGAGGTGAATGATGAAGAATCAAGAAAAAGATTGAGTAGTGTATC
AACAAATAATATAAGTTTGAGATGGGAGAGTAGTGAGAGTTGCACAACACACTCTTCATCATCTGACCAAATCTCTATAG
TTTCTTCACCAGCAATCCTTGTTTCCTTGGGTCATACGCCACTCTACCAATGCAGATCCAAGAAAGGAAACTGGATCACT
ACTGATTCTGAA